Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|338
Gene name
Locationscaffold_1078:739..2527
Strand-
Gene length (bp)1788
Transcript length (bp)1482
Coding sequence length (bp)1479
Protein length (aa) 493

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00117 GATase Glutamine amidotransferase class-I 1.0E-45 276 452
PF00988 CPSase_sm_chain Carbamoyl-phosphate synthase small chain, CPSase domain 1.1E-45 99 231
PF08252 Leader_CPA1 arg-2/CPA1 leader peptide 9.9E-10 1 19

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87183|CARA_HYPVI Carbamoyl-phosphate synthase arginine-specific small chain OS=Hypocrea virens GN=cpa1 PE=3 SV=1 36 493 0.0E+00
sp|Q2H132|CARA_CHAGB Carbamoyl-phosphate synthase arginine-specific small chain OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CPA1 PE=3 SV=1 61 493 0.0E+00
sp|P22572|CARA_NEUCR Carbamoyl-phosphate synthase arginine-specific small chain, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-2 PE=3 SV=2 36 493 0.0E+00
sp|Q0U5H7|CARA_PHANO Carbamoyl-phosphate synthase arginine-specific small chain OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CPA1 PE=3 SV=1 36 487 0.0E+00
sp|Q2U913|CARA_ASPOR Carbamoyl-phosphate synthase arginine-specific small chain OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpa1 PE=3 SV=1 45 486 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87183|CARA_HYPVI Carbamoyl-phosphate synthase arginine-specific small chain OS=Hypocrea virens GN=cpa1 PE=3 SV=1 36 493 0.0E+00
sp|Q2H132|CARA_CHAGB Carbamoyl-phosphate synthase arginine-specific small chain OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CPA1 PE=3 SV=1 61 493 0.0E+00
sp|P22572|CARA_NEUCR Carbamoyl-phosphate synthase arginine-specific small chain, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-2 PE=3 SV=2 36 493 0.0E+00
sp|Q0U5H7|CARA_PHANO Carbamoyl-phosphate synthase arginine-specific small chain OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CPA1 PE=3 SV=1 36 487 0.0E+00
sp|Q2U913|CARA_ASPOR Carbamoyl-phosphate synthase arginine-specific small chain OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpa1 PE=3 SV=1 45 486 0.0E+00
sp|A2R9B9|CARA_ASPNC Carbamoyl-phosphate synthase arginine-specific small chain OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cpa1 PE=3 SV=1 36 486 0.0E+00
sp|A1CZ92|CARA_NEOFI Carbamoyl-phosphate synthase arginine-specific small chain OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cpa1 PE=3 SV=1 36 486 0.0E+00
sp|A1CA18|CARA_ASPCL Carbamoyl-phosphate synthase arginine-specific small chain OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cpa1 PE=3 SV=1 64 486 0.0E+00
sp|Q1DUF5|CARA_COCIM Carbamoyl-phosphate synthase arginine-specific small chain OS=Coccidioides immitis (strain RS) GN=CPA1 PE=3 SV=1 36 484 0.0E+00
sp|Q4WU09|CARA_ASPFU Carbamoyl-phosphate synthase arginine-specific small chain OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cpa1 PE=3 SV=1 95 486 0.0E+00
sp|Q5BB37|CARA_EMENI Carbamoyl-phosphate synthase arginine-specific small chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cpa-1 PE=2 SV=2 95 486 0.0E+00
sp|Q6C9Y4|CARA_YARLI Carbamoyl-phosphate synthase arginine-specific small chain OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CPA1 PE=3 SV=1 48 485 0.0E+00
sp|Q6BJG4|CARA_DEBHA Carbamoyl-phosphate synthase arginine-specific small chain OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CPA1 PE=3 SV=1 56 482 0.0E+00
sp|Q5AML6|CARA_CANAL Carbamoyl-phosphate synthase arginine-specific small chain OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPA1 PE=3 SV=1 95 482 0.0E+00
sp|O60060|CARA_SCHPO Carbamoyl-phosphate synthase arginine-specific small chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg5 PE=3 SV=1 57 452 0.0E+00
sp|P07258|CARA_YEAST Carbamoyl-phosphate synthase arginine-specific small chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPA1 PE=1 SV=1 91 455 6.0E-179
sp|Q6FQ30|CARA_CANGA Carbamoyl-phosphate synthase arginine-specific small chain OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CPA1 PE=3 SV=1 95 458 4.0E-173
sp|Q6CIQ1|CARA_KLULA Carbamoyl-phosphate synthase arginine-specific small chain OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CPA1 PE=3 SV=1 105 454 3.0E-165
sp|Q752N9|CARA_ASHGO Carbamoyl-phosphate synthase arginine-specific small chain OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CPA1 PE=3 SV=1 95 462 3.0E-162
sp|O93937|PYR1_EMENI Protein pyrABCN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pyrABCN PE=3 SV=2 97 455 3.0E-114
sp|Q91437|PYR1_SQUAC CAD protein OS=Squalus acanthias GN=CAD PE=2 SV=1 95 465 2.0E-109
sp|B2RQC6|PYR1_MOUSE CAD protein OS=Mus musculus GN=Cad PE=1 SV=1 95 457 2.0E-106
sp|Q09794|PYR1_SCHPO Protein ura1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura1 PE=1 SV=1 99 463 2.0E-106
sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 95 457 7.0E-106
sp|P07259|PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA2 PE=1 SV=5 96 461 7.0E-105
sp|P08955|PYR1_MESAU CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 95 457 3.0E-104
sp|P05990|PYR1_DROME CAD protein OS=Drosophila melanogaster GN=r PE=1 SV=3 97 489 5.0E-100
sp|Q8U086|CARA_PYRFU Carbamoyl-phosphate synthase small chain OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=carA PE=3 SV=1 97 455 2.0E-99
sp|P20054|PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum GN=pyr1-3 PE=1 SV=3 97 454 6.0E-99
sp|O28995|CARA_ARCFU Carbamoyl-phosphate synthase small chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=carA PE=3 SV=1 93 455 1.0E-97
sp|Q91293|CPSM_LITCT Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Lithobates catesbeiana PE=2 SV=1 95 458 3.0E-95
sp|Q970U8|CARA_SULTO Carbamoyl-phosphate synthase small chain OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=carA PE=3 SV=1 99 460 5.0E-94
sp|P31327|CPSM_HUMAN Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2 95 458 4.0E-89
sp|B2URJ0|CARA_AKKM8 Carbamoyl-phosphate synthase small chain OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=carA PE=3 SV=1 93 458 5.0E-89
sp|Q8C196|CPSM_MOUSE Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Mus musculus GN=Cps1 PE=1 SV=2 95 458 5.0E-89
sp|Q67Q55|CARA_SYMTH Carbamoyl-phosphate synthase small chain OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=carA PE=3 SV=1 99 462 3.0E-88
sp|Q58425|CARA_METJA Carbamoyl-phosphate synthase small chain OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=carA PE=3 SV=2 93 452 4.0E-88
sp|Q4J8E9|CARA_SULAC Carbamoyl-phosphate synthase small chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=carA PE=3 SV=1 94 454 9.0E-88
sp|P07756|CPSM_RAT Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Rattus norvegicus GN=Cps1 PE=1 SV=1 95 458 9.0E-88
sp|P63734|CARA_STRR6 Carbamoyl-phosphate synthase small chain OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=carA PE=3 SV=1 97 460 1.0E-86
sp|P63733|CARA_STRPN Carbamoyl-phosphate synthase small chain OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=carA PE=3 SV=1 97 460 1.0E-86
sp|Q8KGA2|CARA_CHLTE Carbamoyl-phosphate synthase small chain OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=carA PE=3 SV=1 93 459 2.0E-86
sp|Q59968|CARA_SULSO Carbamoyl-phosphate synthase small chain OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=carA PE=3 SV=1 99 450 5.0E-85
sp|A4YI77|CARA_METS5 Carbamoyl-phosphate synthase small chain OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=carA PE=3 SV=1 99 454 2.0E-84
sp|Q9CF80|CARA_LACLA Carbamoyl-phosphate synthase small chain OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=carA PE=3 SV=1 99 451 3.0E-84
sp|B4S5S1|CARA_PROA2 Carbamoyl-phosphate synthase small chain OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=carA PE=3 SV=1 94 458 6.0E-84
sp|P0DA13|CARA_STRPQ Carbamoyl-phosphate synthase small chain OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=carA PE=3 SV=1 99 454 7.0E-84
sp|Q5XCR8|CARA_STRP6 Carbamoyl-phosphate synthase small chain OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=carA PE=3 SV=1 99 454 7.0E-84
sp|P0DA12|CARA_STRP3 Carbamoyl-phosphate synthase small chain OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=carA PE=3 SV=1 99 454 7.0E-84
sp|P63735|CARA_STRP1 Carbamoyl-phosphate synthase small chain OS=Streptococcus pyogenes serotype M1 GN=carA PE=3 SV=1 99 454 7.0E-84
sp|P58894|CARA_STRP8 Carbamoyl-phosphate synthase small chain OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=carA PE=3 SV=1 99 454 1.0E-83
sp|Q8XHB2|CARA_CLOPE Carbamoyl-phosphate synthase small chain OS=Clostridium perfringens (strain 13 / Type A) GN=carA PE=3 SV=1 93 452 2.0E-83
sp|Q8RBK1|CARA_CALS4 Carbamoyl-phosphate synthase small chain OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=carA PE=3 SV=1 93 464 3.0E-83
sp|Q9L4N5|CARA_LACLM Carbamoyl-phosphate synthase small chain OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=carA PE=3 SV=1 99 451 3.0E-83
sp|Q8DUP4|CARA_STRMU Carbamoyl-phosphate synthase small chain OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=carA PE=3 SV=1 97 452 3.0E-83
sp|Q9K8V6|CARX_BACHD Carbamoyl-phosphate synthase arginine-specific small chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=carA PE=3 SV=1 93 464 5.0E-83
sp|Q8ZY49|CARA_PYRAE Carbamoyl-phosphate synthase small chain OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=carA PE=3 SV=1 99 455 2.0E-82
sp|Q3A450|CARA_PELCD Carbamoyl-phosphate synthase small chain OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=carA PE=3 SV=1 93 461 2.0E-82
sp|Q5HPY9|CARA_STAEQ Carbamoyl-phosphate synthase small chain OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=carA PE=3 SV=1 97 462 1.0E-81
sp|Q88DU5|CARA_PSEPK Carbamoyl-phosphate synthase small chain OS=Pseudomonas putida (strain KT2440) GN=carA PE=3 SV=1 94 450 2.0E-81
sp|Q4L5Q4|CARA_STAHJ Carbamoyl-phosphate synthase small chain OS=Staphylococcus haemolyticus (strain JCSC1435) GN=carA PE=3 SV=1 97 462 2.0E-81
sp|Q8RG87|CARA_FUSNN Carbamoyl-phosphate synthase small chain OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=carA PE=3 SV=1 97 455 2.0E-81
sp|Q8CPJ5|CARA_STAES Carbamoyl-phosphate synthase small chain OS=Staphylococcus epidermidis (strain ATCC 12228) GN=carA PE=3 SV=1 97 462 2.0E-81
sp|Q87WP3|CARA_PSESM Carbamoyl-phosphate synthase small chain OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=carA PE=3 SV=1 94 451 1.0E-80
sp|Q9JXX4|CARA_NEIMB Carbamoyl-phosphate synthase small chain OS=Neisseria meningitidis serogroup B (strain MC58) GN=carA PE=3 SV=1 94 460 2.0E-80
sp|Q732I2|CARA_BACC1 Carbamoyl-phosphate synthase small chain OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=carA PE=3 SV=1 97 455 2.0E-80
sp|P63732|CARA_STRA5 Carbamoyl-phosphate synthase small chain OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=carA PE=3 SV=1 99 454 3.0E-80
sp|P63731|CARA_STRA3 Carbamoyl-phosphate synthase small chain OS=Streptococcus agalactiae serotype III (strain NEM316) GN=carA PE=3 SV=1 99 454 3.0E-80
sp|Q9JVZ6|CARA_NEIMA Carbamoyl-phosphate synthase small chain OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=carA PE=3 SV=1 94 460 3.0E-80
sp|Q9PEC2|CARA_XYLFA Carbamoyl-phosphate synthase small chain OS=Xylella fastidiosa (strain 9a5c) GN=carA PE=3 SV=2 94 451 3.0E-80
sp|Q8TY15|CARA_METKA Carbamoyl-phosphate synthase small chain OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=carA PE=3 SV=1 93 451 4.0E-80
sp|Q6F8M7|CARA_ACIAD Carbamoyl-phosphate synthase small chain OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=carA PE=3 SV=1 94 458 5.0E-80
sp|Q6HES7|CARA_BACHK Carbamoyl-phosphate synthase small chain OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=carA PE=3 SV=1 97 455 5.0E-80
sp|Q81WF1|CARA_BACAN Carbamoyl-phosphate synthase small chain OS=Bacillus anthracis GN=carA PE=3 SV=1 97 455 5.0E-80
sp|Q819S2|CARA_BACCR Carbamoyl-phosphate synthase small chain OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=carA PE=3 SV=2 97 455 7.0E-80
sp|Q636D9|CARA_BACCZ Carbamoyl-phosphate synthase small chain OS=Bacillus cereus (strain ZK / E33L) GN=carA PE=3 SV=1 97 455 8.0E-80
sp|Q31LB7|CARA_SYNE7 Carbamoyl-phosphate synthase small chain OS=Synechococcus elongatus (strain PCC 7942) GN=carA PE=3 SV=1 95 451 8.0E-80
sp|Q66ER8|CARA_YERPS Carbamoyl-phosphate synthase small chain OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=carA PE=3 SV=1 95 455 9.0E-80
sp|Q8ZIL5|CARA_YERPE Carbamoyl-phosphate synthase small chain OS=Yersinia pestis GN=carA PE=3 SV=1 95 455 9.0E-80
sp|P58896|CARA_XANCP Carbamoyl-phosphate synthase small chain OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=carA PE=3 SV=1 94 459 1.0E-79
sp|Q8Y664|CARA_LISMO Carbamoyl-phosphate synthase small chain OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=carA PE=3 SV=1 97 452 1.0E-79
sp|Q8Q0U4|CARA_METMA Carbamoyl-phosphate synthase small chain OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=carA PE=3 SV=1 93 447 1.0E-79
sp|Q6GHN3|CARA_STAAR Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain MRSA252) GN=carA PE=3 SV=1 97 462 2.0E-79
sp|Q8FT41|CARA_COREF Carbamoyl-phosphate synthase small chain OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=carA PE=3 SV=1 85 451 2.0E-79
sp|Q8CXH8|CARA_OCEIH Carbamoyl-phosphate synthase small chain OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=carA PE=3 SV=1 97 461 3.0E-79
sp|B8GNX4|CARA_THISH Carbamoyl-phosphate synthase small chain OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=carA PE=3 SV=1 94 452 4.0E-79
sp|Q6D0C8|CARA_PECAS Carbamoyl-phosphate synthase small chain OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=carA PE=3 SV=1 95 462 5.0E-79
sp|A4SXM1|CARA_POLSQ Carbamoyl-phosphate synthase small chain OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=carA PE=3 SV=1 92 462 6.0E-79
sp|O66727|CARA_AQUAE Carbamoyl-phosphate synthase small chain OS=Aquifex aeolicus (strain VF5) GN=carA PE=3 SV=1 95 455 8.0E-79
sp|Q49WY3|CARA_STAS1 Carbamoyl-phosphate synthase small chain OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=carA PE=3 SV=1 97 461 9.0E-79
sp|Q97FT2|CARA_CLOAB Carbamoyl-phosphate synthase small chain OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=carA PE=3 SV=1 93 452 1.0E-78
sp|P63730|CARA_STAAW Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain MW2) GN=carA PE=3 SV=1 97 462 1.0E-78
sp|Q6GA11|CARA_STAAS Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain MSSA476) GN=carA PE=3 SV=1 97 462 1.0E-78
sp|P99147|CARA_STAAN Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain N315) GN=carA PE=1 SV=1 97 462 1.0E-78
sp|P63729|CARA_STAAM Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=carA PE=3 SV=1 97 462 1.0E-78
sp|Q5HGN0|CARA_STAAC Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain COL) GN=carA PE=3 SV=1 97 462 1.0E-78
sp|Q5LTN6|CARA_RUEPO Carbamoyl-phosphate synthase small chain OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=carA PE=3 SV=1 86 450 2.0E-78
sp|Q8RSS4|CARA_HALER Carbamoyl-phosphate synthase small chain OS=Halomonas eurihalina GN=carA PE=3 SV=2 94 455 2.0E-78
sp|Q71YI0|CARA_LISMF Carbamoyl-phosphate synthase small chain OS=Listeria monocytogenes serotype 4b (strain F2365) GN=carA PE=3 SV=1 97 452 2.0E-78
sp|Q8TNY3|CARA_METAC Carbamoyl-phosphate synthase small chain OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=carA PE=3 SV=1 93 447 2.0E-78
sp|P58895|CARA_XANAC Carbamoyl-phosphate synthase small chain OS=Xanthomonas axonopodis pv. citri (strain 306) GN=carA PE=3 SV=1 94 451 4.0E-78
sp|Q5SLL3|CARA_THET8 Carbamoyl-phosphate synthase small chain OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=carA PE=3 SV=1 95 455 4.0E-78
sp|Q72GZ0|CARA_THET2 Carbamoyl-phosphate synthase small chain OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=carA PE=3 SV=1 95 455 4.0E-78
sp|Q5N0L0|CARA_SYNP6 Carbamoyl-phosphate synthase small chain OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=carA PE=3 SV=1 95 451 4.0E-78
sp|Q92AH2|CARA_LISIN Carbamoyl-phosphate synthase small chain OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=carA PE=3 SV=1 97 461 6.0E-78
sp|P36838|CARX_BACSU Carbamoyl-phosphate synthase arginine-specific small chain OS=Bacillus subtilis (strain 168) GN=carA PE=3 SV=2 93 454 9.0E-78
sp|O27079|CARA_METTH Carbamoyl-phosphate synthase small chain OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=carA PE=3 SV=2 95 449 9.0E-78
sp|Q87EB9|CARA_XYLFT Carbamoyl-phosphate synthase small chain OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=carA PE=3 SV=1 95 451 2.0E-77
sp|Q7N8W2|CARA_PHOLL Carbamoyl-phosphate synthase small chain OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=carA PE=3 SV=1 95 468 3.0E-77
sp|B1XUM3|CARA_POLNS Carbamoyl-phosphate synthase small chain OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=carA PE=3 SV=1 94 461 5.0E-77
sp|Q7U7F9|CARA_SYNPX Carbamoyl-phosphate synthase small chain OS=Synechococcus sp. (strain WH8102) GN=carA PE=3 SV=1 95 451 6.0E-77
sp|C5BQ30|CARA_TERTT Carbamoyl-phosphate synthase small chain OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=carA PE=3 SV=1 93 455 8.0E-77
sp|P0A6F1|CARA_ECOLI Carbamoyl-phosphate synthase small chain OS=Escherichia coli (strain K12) GN=carA PE=1 SV=1 95 455 8.0E-77
sp|P0A6F2|CARA_ECO57 Carbamoyl-phosphate synthase small chain OS=Escherichia coli O157:H7 GN=carA PE=3 SV=1 95 455 8.0E-77
sp|Q9JP87|CARA_RUBGI Carbamoyl-phosphate synthase small chain OS=Rubrivivax gelatinosus (strain NBRC 100245 / IL144) GN=carA PE=3 SV=1 92 455 9.0E-77
sp|P38098|CARA_PSEAE Carbamoyl-phosphate synthase small chain OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=carA PE=3 SV=1 94 451 1.0E-76
sp|Q9RWI4|CARA_DEIRA Carbamoyl-phosphate synthase small chain OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=carA PE=3 SV=1 95 454 1.0E-76
sp|Q9K9V8|CARA_BACHD Carbamoyl-phosphate synthase pyrimidine-specific small chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pyrAA PE=3 SV=1 97 459 1.0E-76
sp|P14845|CARA_SALTY Carbamoyl-phosphate synthase small chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=carA PE=3 SV=2 95 462 1.0E-76
sp|Q8FLB1|CARA_ECOL6 Carbamoyl-phosphate synthase small chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=carA PE=3 SV=2 95 455 1.0E-76
sp|Q8YXQ7|CARA_NOSS1 Carbamoyl-phosphate synthase small chain OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=carA PE=3 SV=1 93 460 2.0E-76
sp|Q50983|CARA_NEIGO Carbamoyl-phosphate synthase small chain OS=Neisseria gonorrhoeae GN=carA PE=3 SV=1 94 460 2.0E-76
sp|A4G0Y3|CARA_METM5 Carbamoyl-phosphate synthase small chain OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=carA PE=3 SV=1 97 452 2.0E-76
sp|A6VHH7|CARA_METM7 Carbamoyl-phosphate synthase small chain OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=carA PE=3 SV=1 97 464 3.0E-76
sp|Q6LWW5|CARA_METMP Carbamoyl-phosphate synthase small chain OS=Methanococcus maripaludis (strain S2 / LL) GN=carA PE=3 SV=1 97 452 3.0E-76
sp|A9A972|CARA_METM6 Carbamoyl-phosphate synthase small chain OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=carA PE=3 SV=1 97 452 4.0E-76
sp|Q1IWN0|CARA_DEIGD Carbamoyl-phosphate synthase small chain OS=Deinococcus geothermalis (strain DSM 11300) GN=carA PE=3 SV=1 95 460 6.0E-76
sp|Q8F6R2|CARA_LEPIN Carbamoyl-phosphate synthase small chain OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=carA PE=3 SV=2 93 460 7.0E-76
sp|P52557|CARA_BACCL Carbamoyl-phosphate synthase pyrimidine-specific small chain OS=Bacillus caldolyticus GN=pyrAA PE=3 SV=1 97 451 8.0E-76
sp|Q72PK5|CARA_LEPIC Carbamoyl-phosphate synthase small chain OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=carA PE=3 SV=1 92 460 1.0E-75
sp|A6WZJ5|CARA_OCHA4 Carbamoyl-phosphate synthase small chain OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=carA PE=3 SV=1 95 458 2.0E-75
sp|Q8Z9L8|CARA_SALTI Carbamoyl-phosphate synthase small chain OS=Salmonella typhi GN=carA PE=3 SV=1 95 455 2.0E-75
sp|Q8FZJ8|CARA_BRUSU Carbamoyl-phosphate synthase small chain OS=Brucella suis biovar 1 (strain 1330) GN=carA PE=3 SV=1 95 458 2.0E-75
sp|A9M6F1|CARA_BRUC2 Carbamoyl-phosphate synthase small chain OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=carA PE=3 SV=1 95 458 2.0E-75
sp|B0CHS0|CARA_BRUSI Carbamoyl-phosphate synthase small chain OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=carA PE=3 SV=1 95 458 2.0E-75
sp|P59576|CARA_BUCBP Carbamoyl-phosphate synthase small chain OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=carA PE=3 SV=1 93 462 2.0E-75
sp|P77885|CARA_LACPL Carbamoyl-phosphate synthase pyrimidine-specific small chain OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pyrAA PE=3 SV=2 97 451 3.0E-75
sp|Q9KPH8|CARA_VIBCH Carbamoyl-phosphate synthase small chain OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=carA PE=3 SV=1 95 455 3.0E-75
sp|A5VRM1|CARA_BRUO2 Carbamoyl-phosphate synthase small chain OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=carA PE=3 SV=1 95 458 9.0E-75
sp|Q8YIB8|CARA_BRUME Carbamoyl-phosphate synthase small chain OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=carA PE=3 SV=2 95 458 9.0E-75
sp|C0REC2|CARA_BRUMB Carbamoyl-phosphate synthase small chain OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=carA PE=3 SV=1 95 458 9.0E-75
sp|Q57C28|CARA_BRUAB Carbamoyl-phosphate synthase small chain OS=Brucella abortus biovar 1 (strain 9-941) GN=carA PE=3 SV=1 95 458 9.0E-75
sp|Q2YM22|CARA_BRUA2 Carbamoyl-phosphate synthase small chain OS=Brucella abortus (strain 2308) GN=carA PE=3 SV=1 95 458 9.0E-75
sp|B2S6U9|CARA_BRUA1 Carbamoyl-phosphate synthase small chain OS=Brucella abortus (strain S19) GN=carA PE=3 SV=1 95 458 9.0E-75
sp|Q8KZA0|CARA_DESVM Carbamoyl-phosphate synthase small chain OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=carA PE=3 SV=1 93 457 1.0E-74
sp|Q04ZG6|CARA_LEPBL Carbamoyl-phosphate synthase small chain OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=carA PE=3 SV=1 93 461 1.0E-74
sp|Q04R57|CARA_LEPBJ Carbamoyl-phosphate synthase small chain OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=carA PE=3 SV=1 93 461 1.0E-74
sp|Q8XZ85|CARA_RALSO Carbamoyl-phosphate synthase small chain OS=Ralstonia solanacearum (strain GMI1000) GN=carA PE=3 SV=1 94 450 1.0E-74
sp|P38099|CARA_PSEST Carbamoyl-phosphate synthase small chain OS=Pseudomonas stutzeri GN=carA PE=3 SV=1 91 451 2.0E-74
sp|Q8EHS6|CARA_SHEON Carbamoyl-phosphate synthase small chain OS=Shewanella oneidensis (strain MR-1) GN=carA PE=3 SV=1 95 455 3.0E-74
sp|Q6LUK6|CARA_PHOPR Carbamoyl-phosphate synthase small chain OS=Photobacterium profundum GN=carA PE=3 SV=1 95 462 3.0E-74
sp|P25993|CARA_BACSU Carbamoyl-phosphate synthase pyrimidine-specific small chain OS=Bacillus subtilis (strain 168) GN=pyrAA PE=3 SV=1 97 455 4.0E-74
sp|C4XRH8|CARA_DESMR Carbamoyl-phosphate synthase small chain OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=carA PE=3 SV=1 93 455 4.0E-74
sp|Q6NH15|CARA_CORDI Carbamoyl-phosphate synthase small chain OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=carA PE=3 SV=1 95 458 4.0E-74
sp|Q7MNU1|CARA_VIBVY Carbamoyl-phosphate synthase small chain OS=Vibrio vulnificus (strain YJ016) GN=carA PE=3 SV=1 95 455 4.0E-74
sp|Q8DEM1|CARA_VIBVU Carbamoyl-phosphate synthase small chain OS=Vibrio vulnificus (strain CMCP6) GN=carA PE=3 SV=1 95 455 5.0E-74
sp|A1VA26|CARA_DESVV Carbamoyl-phosphate synthase small chain OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=carA PE=3 SV=1 93 457 5.0E-74
sp|Q726J4|CARA_DESVH Carbamoyl-phosphate synthase small chain OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=carA PE=3 SV=1 93 457 5.0E-74
sp|Q9CKV3|CARA_PASMU Carbamoyl-phosphate synthase small chain OS=Pasteurella multocida (strain Pm70) GN=carA PE=3 SV=1 94 461 1.0E-73
sp|Q87SF4|CARA_VIBPA Carbamoyl-phosphate synthase small chain OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=carA PE=3 SV=1 95 455 1.0E-73
sp|P54324|CARX_GEOSE Carbamoyl-phosphate synthase arginine-specific small chain OS=Geobacillus stearothermophilus GN=carA PE=1 SV=1 93 459 2.0E-73
sp|Q827Q8|CARA_STRAW Carbamoyl-phosphate synthase small chain OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=carA PE=3 SV=1 86 451 2.0E-73
sp|Q7UGJ6|CARA_RHOBA Carbamoyl-phosphate synthase small chain OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=carA PE=3 SV=1 95 454 4.0E-73
sp|Q6FZ66|CARA_BARQU Carbamoyl-phosphate synthase small chain OS=Bartonella quintana (strain Toulouse) GN=carA PE=3 SV=1 77 452 4.0E-73
sp|Q9KXR5|CARA_STRCO Carbamoyl-phosphate synthase small chain OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=carA PE=3 SV=1 94 451 4.0E-73
sp|Q6YV23|CARA_ORYSJ Carbamoyl-phosphate synthase small chain, chloroplastic OS=Oryza sativa subsp. japonica GN=CARA PE=2 SV=2 89 455 4.0E-73
sp|Q8DKU5|CARA_THEEB Carbamoyl-phosphate synthase small chain OS=Thermosynechococcus elongatus (strain BP-1) GN=carA PE=3 SV=1 94 471 5.0E-73
sp|Q98IA7|CARA_RHILO Carbamoyl-phosphate synthase small chain OS=Rhizobium loti (strain MAFF303099) GN=carA PE=3 SV=1 89 463 4.0E-72
sp|P57245|CARA_BUCAI Carbamoyl-phosphate synthase small chain OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=carA PE=3 SV=1 95 452 2.0E-71
sp|A6UQN4|CARA_METVS Carbamoyl-phosphate synthase small chain OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=carA PE=3 SV=1 95 448 3.0E-71
sp|P74587|CARA_SYNY3 Carbamoyl-phosphate synthase small chain OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=carA PE=3 SV=2 91 458 3.0E-71
sp|Q89DR8|CARA_BRADU Carbamoyl-phosphate synthase small chain OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=carA PE=3 SV=1 89 460 7.0E-71
sp|Q9WZ28|CARA_THEMA Carbamoyl-phosphate synthase small chain OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=carA PE=3 SV=1 95 455 2.0E-70
sp|C6C0A9|CARA_DESAD Carbamoyl-phosphate synthase small chain OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=carA PE=3 SV=1 93 457 2.0E-70
sp|Q6G5M0|CARA_BARHE Carbamoyl-phosphate synthase small chain OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=carA PE=3 SV=1 89 452 3.0E-70
sp|Q9A4J7|CARA_CAUCR Carbamoyl-phosphate synthase small chain OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=carA PE=3 SV=1 92 458 5.0E-70
sp|Q7VP66|CARA_HAEDU Carbamoyl-phosphate synthase small chain OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=carA PE=3 SV=1 94 458 8.0E-70
sp|A1UTE8|CARA_BARBK Carbamoyl-phosphate synthase small chain OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=carA PE=3 SV=1 89 450 9.0E-70
sp|Q92N95|CARA_RHIME Carbamoyl-phosphate synthase small chain OS=Rhizobium meliloti (strain 1021) GN=carA PE=3 SV=1 89 458 2.0E-69
sp|P58893|CARA_CORGL Carbamoyl-phosphate synthase small chain OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=carA PE=3 SV=1 85 452 3.0E-69
sp|A9IWF8|CARA_BART1 Carbamoyl-phosphate synthase small chain OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=carA PE=3 SV=1 81 450 3.0E-69
sp|B8IZS6|CARA_DESDA Carbamoyl-phosphate synthase small chain OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=carA PE=3 SV=1 93 450 2.0E-68
sp|A5GTM5|CARA_SYNR3 Carbamoyl-phosphate synthase small chain OS=Synechococcus sp. (strain RCC307) GN=carA PE=3 SV=1 93 465 3.0E-68
sp|Q8UDF7|CARA_AGRFC Carbamoyl-phosphate synthase small chain OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=carA PE=3 SV=2 95 452 3.0E-68
sp|Q9LVW7|CARA_ARATH Carbamoyl-phosphate synthase small chain, chloroplastic OS=Arabidopsis thaliana GN=CARA PE=1 SV=1 95 460 3.0E-68
sp|Q6B940|CARA_GRATL Carbamoyl-phosphate synthase small chain OS=Gracilaria tenuistipitata var. liui GN=carA PE=3 SV=1 92 471 3.0E-67
sp|Q7VHS5|CARA_HELHP Carbamoyl-phosphate synthase small chain OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=carA PE=3 SV=1 92 450 5.0E-67
sp|Q0BY73|CARA_HYPNA Carbamoyl-phosphate synthase small chain OS=Hyphomonas neptunium (strain ATCC 15444) GN=carA PE=3 SV=1 118 450 5.0E-67
sp|Q741H2|CARA_MYCPA Carbamoyl-phosphate synthase small chain OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=carA PE=3 SV=1 95 452 3.0E-66
sp|P9WPK5|CARA_MYCTU Carbamoyl-phosphate synthase small chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=carA PE=1 SV=1 95 452 5.0E-66
sp|P9WPK4|CARA_MYCTO Carbamoyl-phosphate synthase small chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=carA PE=3 SV=1 95 452 5.0E-66
sp|O19886|CARA_CYACA Carbamoyl-phosphate synthase small chain OS=Cyanidium caldarium GN=carA PE=3 SV=1 94 460 6.0E-66
sp|Q8G816|CARA_BIFLO Carbamoyl-phosphate synthase small chain OS=Bifidobacterium longum (strain NCC 2705) GN=carA PE=3 SV=1 95 465 1.0E-65
sp|Q7U055|CARA_MYCBO Carbamoyl-phosphate synthase small chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=carA PE=3 SV=1 95 452 2.0E-65
sp|Q8K9Z6|CARA_BUCAP Carbamoyl-phosphate synthase small chain OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=carA PE=3 SV=1 95 452 3.0E-65
sp|B3DQ31|CARA_BIFLD Carbamoyl-phosphate synthase small chain OS=Bifidobacterium longum (strain DJO10A) GN=carA PE=3 SV=1 95 465 4.0E-65
sp|B7GPW1|CARA_BIFLS Carbamoyl-phosphate synthase small chain OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=carA PE=3 SV=1 95 465 2.0E-64
sp|O50235|CARA_ZYMMO Carbamoyl-phosphate synthase small chain OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=carA PE=3 SV=2 97 451 1.0E-63
sp|Q1MPN3|CARA_LAWIP Carbamoyl-phosphate synthase small chain OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=carA PE=3 SV=1 93 456 2.0E-63
sp|Q9CCR3|CARA_MYCLE Carbamoyl-phosphate synthase small chain OS=Mycobacterium leprae (strain TN) GN=carA PE=3 SV=1 95 452 4.0E-63
sp|P51201|CARA_PORPU Carbamoyl-phosphate synthase small chain OS=Porphyra purpurea GN=carA PE=3 SV=1 90 452 5.0E-63
sp|Q1XDT6|CARA_PYRYE Carbamoyl-phosphate synthase small chain OS=Pyropia yezoensis GN=carA PE=3 SV=1 93 459 1.0E-61
sp|Q0AMR3|CARA_MARMM Carbamoyl-phosphate synthase small chain OS=Maricaulis maris (strain MCS10) GN=carA PE=3 SV=1 97 455 1.0E-61
sp|O08317|CARX_LACPL Carbamoyl-phosphate synthase arginine-specific small chain OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=carA PE=2 SV=3 97 455 6.0E-61
sp|Q9PMG8|CARA_CAMJE Carbamoyl-phosphate synthase small chain OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=carA PE=3 SV=1 93 451 6.0E-61
sp|Q9ZJY9|CARA_HELPJ Carbamoyl-phosphate synthase small chain OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=carA PE=3 SV=1 96 451 2.0E-60
sp|Q8D3H7|CARA_WIGBR Carbamoyl-phosphate synthase small chain OS=Wigglesworthia glossinidia brevipalpis GN=carA PE=3 SV=1 90 455 6.0E-60
sp|O25835|CARA_HELPY Carbamoyl-phosphate synthase small chain OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=carA PE=3 SV=1 96 452 4.0E-59
sp|Q9HP42|CARA_HALSA Carbamoyl-phosphate synthase small chain OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=carA PE=3 SV=1 118 451 1.0E-57
sp|B0R6F1|CARA_HALS3 Carbamoyl-phosphate synthase small chain OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=carA PE=3 SV=1 118 451 1.0E-57
sp|Q17VI1|CARA_HELAH Carbamoyl-phosphate synthase small chain OS=Helicobacter acinonychis (strain Sheeba) GN=carA PE=3 SV=1 96 452 2.0E-55
sp|Q9HK16|CARA_THEAC Carbamoyl-phosphate synthase small chain OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=carA PE=3 SV=2 101 457 4.0E-53
sp|Q97AJ4|CARA_THEVO Carbamoyl-phosphate synthase small chain OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=carA PE=3 SV=1 93 457 3.0E-52
sp|Q9YGB2|TRPG_THEKO Anthranilate synthase component 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpG PE=3 SV=1 313 436 3.0E-11
sp|Q12UJ5|GUAAA_METBU GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=guaAA PE=3 SV=1 313 436 7.0E-11
sp|P32483|PABS_STRGR Para-aminobenzoate synthase OS=Streptomyces griseus GN=pab PE=3 SV=1 312 438 1.0E-10
sp|Q08654|TRPGD_THEMA Bifunctional protein TrpGD OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpGD PE=3 SV=2 315 466 7.0E-10
sp|C0R5H8|GUAA_WOLWR GMP synthase [glutamine-hydrolyzing] OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=guaA PE=3 SV=1 274 437 2.0E-09
sp|Q73IH1|GUAA_WOLPM GMP synthase [glutamine-hydrolyzing] OS=Wolbachia pipientis wMel GN=guaA PE=3 SV=1 274 437 2.0E-09
sp|Q58970|GUAAA_METJA GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=guaAA PE=1 SV=1 285 435 4.0E-09
sp|Q97VZ9|GUAAA_SULSO GMP synthase [glutamine-hydrolyzing] subunit A OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=guaAA PE=3 SV=1 274 437 5.0E-09
sp|Q8PXF0|GUAAA_METMA GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=guaAA PE=3 SV=1 298 436 7.0E-09
sp|Q9HJM3|GUAAA_THEAC GMP synthase [glutamine-hydrolyzing] subunit A OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=guaAA PE=1 SV=2 287 467 2.0E-08
sp|Q46E00|GUAAA_METBF GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=guaAA PE=3 SV=1 285 435 6.0E-08
sp|Q8G5P4|GUAA_BIFLO GMP synthase [glutamine-hydrolyzing] OS=Bifidobacterium longum (strain NCC 2705) GN=guaA PE=3 SV=1 274 483 7.0E-08
sp|Q57690|TRPG_METJA Anthranilate synthase component 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpG PE=3 SV=1 313 436 2.0E-07
sp|Q0W700|GUAAA_METAR GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=guaAA PE=3 SV=1 308 436 2.0E-07
sp|P20409|TRPG_PHYBL Multifunctional tryptophan biosynthesis protein OS=Phycomyces blakesleeanus GN=trp1 PE=3 SV=1 284 436 3.0E-07
sp|P15395|TRPE_RHIME Anthranilate synthase OS=Rhizobium meliloti (strain 1021) GN=trpE(G) PE=3 SV=1 313 436 5.0E-07
sp|Q8U0R9|GUAAA_PYRFU GMP synthase [glutamine-hydrolyzing] subunit A OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=guaAA PE=3 SV=1 285 436 6.0E-07
sp|Q8THC7|GUAAA_METAC GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=guaAA PE=3 SV=1 285 436 6.0E-07
sp|P9WN35|TRPG_MYCTU Anthranilate synthase component 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trpG PE=1 SV=1 308 436 6.0E-07
sp|P9WN34|TRPG_MYCTO Anthranilate synthase component 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trpG PE=3 SV=1 308 436 6.0E-07
sp|Q5V632|TRPG2_HALMA Anthranilate synthase component II OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpG2 PE=3 SV=1 313 436 3.0E-06
sp|Q979P8|GUAAA_THEVO GMP synthase [glutamine-hydrolyzing] subunit A OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=guaAA PE=3 SV=1 287 437 3.0E-06
sp|Q974T4|GUAAA_SULTO GMP synthase [glutamine-hydrolyzing] subunit A OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=guaAA PE=3 SV=1 274 437 4.0E-06
sp|P00902|TRPG_ACIAD Anthranilate synthase component 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=trpG PE=3 SV=1 320 436 4.0E-06
sp|P00937|TRPG_YEAST Multifunctional tryptophan biosynthesis protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP3 PE=1 SV=2 273 481 5.0E-06
sp|A6VH31|GUAAA_METM7 GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=guaAA PE=3 SV=1 285 436 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|338
MNGRSSVFTSQDYLSDHLWSPSPLFPTTKQPPAAVMFTRLVVPFAKPAVTRAAFSRPSAFQVRFLSRNVAATGST
GRKMPSKNLQATAPVALLPATFTIRDGPVFQGKAFGANSNISGEAVFTTSLVGYPESMTDPSYRGQILVFTQPLI
GNYGVPSNQRDSYNLLKHFESPHIQCAGVVVSDVALNYSHWTAVESLGEWCAREGVPAISGVDTRAIVTHLREQG
ASLARITIGDEYDADEDESYVDPSLINLVKRVSTKAPFVVESPGAAFHVALIDCGVKENILRGLVSRGASVTVFP
HDYPIHKVAQHFDGVFISNGPGDPTHCQATVFNLARLIETSSIPVMGICLGHQLLALAVGARTIKLKYGNRAHNI
PALDLTTGQCHITSQNHGYAVDASTLPSEFKEYFVNLNDGSNEGMLHKTRPIFSTQFHPEAKGGPMDSAYLFDKY
LQNVQLAKNAQRVYKDNRPSQLVLDILNKERVGVDPAPLASVA
Coding >Ophio5|338
ATGAACGGGCGCTCGTCGGTCTTCACTTCTCAGGATTATCTCTCTGACCACTTGTGGAGTCCCTCTCCCCTCTTT
CCGACTACAAAACAACCTCCCGCCGCCGTCATGTTCACCCGACTGGTCGTCCCTTTCGCCAAACCGGCCGTCACT
CGGGCCGCCTTCTCCCGCCCATCCGCCTTTCAGGTCCGCTTCCTGTCTCGCAATGTCGCTGCTACTGGTAGCACC
GGCAGGAAAATGCCCTCCAAGAACCTCCAGGCCACGGCTCCTGTCGCGTTGCTGCCCGCCACTTTCACCATCAGG
GATGGGCCCGTGTTCCAGGGCAAGGCCTTTGGCGCCAACTCCAACATCTCGGGTGAAGCCGTCTTCACCACCTCT
CTCGTTGGGTATCCCGAGTCTATGACCGACCCTTCGTACCGCGGCCAGATCCTCGTCTTCACTCAGCCGCTCATC
GGCAACTACGGAGTCCCCTCGAACCAGCGAGACTCGTACAACCTCCTCAAGCACTTCGAATCCCCCCACATTCAG
TGTGCCGGTGTCGTCGTCTCCGACGTCGCTCTCAACTACAGCCACTGGACCGCTGTGGAGAGCCTGGGCGAGTGG
TGTGCTCGCGAGGGCGTCCCGGCCATTTCCGGCGTCGATACCCGTGCCATTGTCACCCACCTCCGCGAGCAGGGC
GCCTCCCTCGCCCGCATCACCATTGGTGACGAGTATGACGCCGATGAGGACGAGAGCTACGTCGATCCCAGCCTG
ATCAACCTGGTCAAGCGCGTGAGCACCAAGGCTCCCTTCGTCGTAGAGTCCCCCGGCGCCGCCTTCCACGTCGCC
CTCATCGACTGCGGCGTCAAGGAGAACATCCTCCGCGGCCTCGTCAGCCGCGGGGCCTCCGTCACCGTCTTCCCC
CACGACTATCCCATCCACAAGGTCGCCCAGCACTTTGACGGCGTCTTCATCTCCAATGGGCCCGGCGACCCGACC
CATTGCCAGGCTACCGTCTTCAACCTGGCTCGCCTGATCGAGACGTCGTCCATCCCCGTCATGGGCATCTGCCTC
GGCCACCAGCTACTCGCCCTGGCCGTCGGCGCCCGCACCATTAAGCTCAAATACGGCAACCGCGCTCACAACATC
CCCGCACTCGACCTCACCACGGGCCAATGCCACATCACGAGTCAGAACCACGGCTACGCTGTCGATGCCAGCACT
CTGCCTAGCGAGTTTAAGGAGTATTTTGTCAACCTCAACGACGGCAGCAATGAGGGCATGCTGCACAAGACGCGC
CCCATCTTCTCGACTCAGTTCCATCCCGAAGCCAAGGGTGGCCCCATGGACAGTGCCTATCTCTTCGACAAGTAC
CTGCAGAACGTCCAGCTGGCCAAGAACGCCCAGCGCGTCTACAAGGACAACCGGCCCAGCCAGTTGGTGCTCGAC
ATACTCAACAAGGAGCGTGTCGGCGTCGATCCTGCCCCGCTCGCCAGCGTCGCC
Transcript >Ophio5|338
ATGAACGGGCGCTCGTCGGTCTTCACTTCTCAGGATTATCTCTCTGACCACTTGTGGAGTCCCTCTCCCCTCTTT
CCGACTACAAAACAACCTCCCGCCGCCGTCATGTTCACCCGACTGGTCGTCCCTTTCGCCAAACCGGCCGTCACT
CGGGCCGCCTTCTCCCGCCCATCCGCCTTTCAGGTCCGCTTCCTGTCTCGCAATGTCGCTGCTACTGGTAGCACC
GGCAGGAAAATGCCCTCCAAGAACCTCCAGGCCACGGCTCCTGTCGCGTTGCTGCCCGCCACTTTCACCATCAGG
GATGGGCCCGTGTTCCAGGGCAAGGCCTTTGGCGCCAACTCCAACATCTCGGGTGAAGCCGTCTTCACCACCTCT
CTCGTTGGGTATCCCGAGTCTATGACCGACCCTTCGTACCGCGGCCAGATCCTCGTCTTCACTCAGCCGCTCATC
GGCAACTACGGAGTCCCCTCGAACCAGCGAGACTCGTACAACCTCCTCAAGCACTTCGAATCCCCCCACATTCAG
TGTGCCGGTGTCGTCGTCTCCGACGTCGCTCTCAACTACAGCCACTGGACCGCTGTGGAGAGCCTGGGCGAGTGG
TGTGCTCGCGAGGGCGTCCCGGCCATTTCCGGCGTCGATACCCGTGCCATTGTCACCCACCTCCGCGAGCAGGGC
GCCTCCCTCGCCCGCATCACCATTGGTGACGAGTATGACGCCGATGAGGACGAGAGCTACGTCGATCCCAGCCTG
ATCAACCTGGTCAAGCGCGTGAGCACCAAGGCTCCCTTCGTCGTAGAGTCCCCCGGCGCCGCCTTCCACGTCGCC
CTCATCGACTGCGGCGTCAAGGAGAACATCCTCCGCGGCCTCGTCAGCCGCGGGGCCTCCGTCACCGTCTTCCCC
CACGACTATCCCATCCACAAGGTCGCCCAGCACTTTGACGGCGTCTTCATCTCCAATGGGCCCGGCGACCCGACC
CATTGCCAGGCTACCGTCTTCAACCTGGCTCGCCTGATCGAGACGTCGTCCATCCCCGTCATGGGCATCTGCCTC
GGCCACCAGCTACTCGCCCTGGCCGTCGGCGCCCGCACCATTAAGCTCAAATACGGCAACCGCGCTCACAACATC
CCCGCACTCGACCTCACCACGGGCCAATGCCACATCACGAGTCAGAACCACGGCTACGCTGTCGATGCCAGCACT
CTGCCTAGCGAGTTTAAGGAGTATTTTGTCAACCTCAACGACGGCAGCAATGAGGGCATGCTGCACAAGACGCGC
CCCATCTTCTCGACTCAGTTCCATCCCGAAGCCAAGGGTGGCCCCATGGACAGTGCCTATCTCTTCGACAAGTAC
CTGCAGAACGTCCAGCTGGCCAAGAACGCCCAGCGCGTCTACAAGGACAACCGGCCCAGCCAGTTGGTGCTCGAC
ATACTCAACAAGGAGCGTGTCGGCGTCGATCCTGCCCCGCTCGCCAGCGTCGCCTAG
Gene >Ophio5|338
ATGAACGGGCGCTCGTCGGTCTTCACTTCTCAGGTACTTTCTCCTCCATCATGCGTGCCCACCAAACAATCCCAA
ACTAATGGCTTCTTCTGCAGGATTATCTCTCTGGTGCGTCGTCACCTGCCATGACCTGACCTACCGCCTCGTTCC
CTCCAGCTGATCCCATCTCCCTTTCTCAATAGACCACTTGTGGAGGTCTCTGTCGGCTTAAGCCCTTTGTCTCTT
CTCCGACCTCGCACACAGTCCCTCTCCCCTCTTTCCGACTACAAAACAACCTCCCGCCGCCGTCATGTTCACCCG
ACTGGTCGTCCCTTTCGCCAAACCGGCCGTCACTCGGGCCGCCTTCTCCCGCCCATCCGCCTTTCAGGTCCGCTT
CCTGTCTCGCAATGTCGCTGCTACTGGTAGCACCGGCAGGAAAATGCCCTCCAAGAACCTCCAGGCCACGGCTCC
TGTCGCGTTGCTGCCCGCCACTTTCACCATCAGGGTGAGCCCAACCCCTCACCTCCGTCCGGGTCGTCCGCTGAC
GATCCCTCGCTTTGCAGGATGGGCCCGTGTTCCAGGGCAAGGCCTTTGGCGCCAACTCCAACATCTCGGGTGAAG
CCGTCTTCACCACCTCTCTCGTTGGGTATCCCGAGTCTATGACCGACCCTTCGTACCGCGGCCAGATCCTCGTCT
TCACTCAGCCGCTCATCGGCAACTACGGAGTCCCCTCGAACCAGCGAGACTCGTACAACCTCCTCAAGCACTTCG
AATCCCCCCACATTCAGTGTGCCGGTGTCGTCGTCTCCGACGTCGCTCTCAACTACAGCCACTGGACCGCTGTGG
AGAGCCTGGGCGAGTGGTGTGCTCGCGAGGGCGTCCCGGCCATTTCCGGCGTCGATACCCGTGCCATTGTCACCC
ACCTCCGCGAGCAGGGCGCCTCCCTCGCCCGCATCACCATTGGTGACGAGTATGACGCCGATGAGGACGAGAGCT
ACGTCGATCCCAGCCTGATCAACCTGGTCAAGCGCGTGAGCACCAAGGCTCCCTTCGTCGTAGAGTCCCCCGGCG
CCGCCTTCCACGTCGCCCTCATCGACTGCGGCGTCAAGGAGAACATCCTCCGCGGCCTCGTCAGCCGCGGGGCCT
CCGTCACCGTCTTCCCCCACGACTATCCCATCCACAAGGTCGCCCAGCACTTTGACGGCGTCTTCATCTCCAATG
GGCCCGGCGACCCGACCCATTGCCAGGCTACCGTCTTCAACCTGGCTCGCCTGATCGAGACGTCGTCCATCCCCG
TCATGGGCATCTGCCTCGGCCACCAGCTACTCGCCCTGGCCGTCGGCGCCCGCACCATTAAGCTCAAATACGGCA
ACCGCGCTCACAACATCCCCGCACTCGACCTCACCACGGGCCAATGCCACATCACGAGTCAGAACCACGGCTACG
CTGTCGATGCCAGCACTCTGCCTAGCGAGTTTAAGGAGTATTTTGTCAACCTCAACGACGGCAGCAATGAGGGTA
AGTCTCAACCTGTCCCGTCCCGCGACGACACCTTTGGCCTGTTCTGACGAAGCTTTGGCAGGCATGCTGCACAAG
ACGCGCCCCATCTTCTCGACTCAGTTCCATCCCGAAGCCAAGGGTGGCCCCATGGACAGTGCCTATCTCTTCGAC
AAGTACCTGCAGAACGTCCAGCTGGCCAAGAACGCCCAGCGCGTCTACAAGGACAACCGGCCCAGCCAGTTGGTG
CTCGACATACTCAACAAGGAGCGTGTCGGCGTCGATCCTGCCCCGCTCGCCAGCGTCGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail