Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3377
Gene name
Locationscaffold_269:655..1579
Strand+
Gene length (bp)924
Transcript length (bp)876
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 9.1E-08 170 249
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 3.7E-04 173 205

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59806|YJV8_SCHPO Uncharacterized N-acetyltransferase C550.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.08 PE=3 SV=1 44 287 1.0E-40

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016746 acyltransferase activity No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0016410 N-acyltransferase activity No
GO:0003674 molecular_function No
GO:0016407 acetyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3377
MNPAGSKPSCPEAETSAPTGGSSSAAPSRDLEASSLTPATWLTSVREVPMSERREASFSLAFAFASDPLSVYLLA
GDGSNLTAEQTWALHLRIMSCTFAAYRIRGIVTTIGPDYDAIALWTPPGKFMDDWWATFRSGTWRLAYQLPVEAR
KRFFDELVPALHDTREKTMGERNNDTWYLGYIATKPSARGRGYASKLIRDVTQKAGLTISVETPSPPSPPPGADA
ENRPIYLESTSGSNNGFYAKFGFETKSLIELKRGPVPIRLCCMVREPHPVQLRASETESSNEGVKV
Coding >Ophio5|3377
ATGAATCCGGCCGGTAGTAAGCCGAGTTGTCCGGAGGCCGAGACGTCGGCCCCGACCGGAGGTTCCTCATCGGCA
GCCCCGTCACGCGACCTAGAAGCGTCGTCGCTCACGCCGGCGACATGGTTGACTTCGGTGCGAGAGGTGCCGATG
AGTGAGCGTCGCGAGGCCTCCTTCTCGCTCGCTTTTGCCTTTGCCTCGGATCCGCTGAGCGTCTACCTCCTCGCC
GGTGACGGTTCGAACCTGACGGCCGAGCAGACTTGGGCGCTTCATCTGCGCATCATGTCATGCACCTTCGCCGCC
TATCGGATCCGAGGCATCGTCACCACCATCGGGCCGGACTACGACGCCATAGCCCTATGGACGCCTCCTGGAAAG
TTCATGGACGACTGGTGGGCTACCTTCCGAAGCGGCACTTGGCGTCTCGCCTATCAGTTGCCCGTCGAGGCTCGA
AAGCGCTTCTTCGATGAGCTCGTGCCCGCGCTGCACGATACGCGCGAGAAGACCATGGGCGAGCGAAACAACGAT
ACCTGGTATCTCGGCTATATCGCTACCAAGCCTAGTGCCCGTGGTCGCGGCTACGCTTCCAAGTTGATTCGCGAC
GTGACGCAAAAGGCAGGCTTGACCATCTCAGTCGAAACCCCTTCCCCCCCTTCCCCCCCCCCGGGTGCTGATGCC
GAGAACCGACCCATATATCTCGAGTCGACGTCGGGCAGCAACAACGGCTTCTACGCAAAGTTTGGCTTCGAGACA
AAGTCGCTTATTGAGCTGAAGCGTGGGCCTGTGCCTATCCGGCTGTGTTGTATGGTTCGTGAGCCGCATCCTGTC
CAGCTGCGCGCCTCTGAGACCGAGTCGTCCAACGAGGGCGTCAAAGTC
Transcript >Ophio5|3377
ATGAATCCGGCCGGTAGTAAGCCGAGTTGTCCGGAGGCCGAGACGTCGGCCCCGACCGGAGGTTCCTCATCGGCA
GCCCCGTCACGCGACCTAGAAGCGTCGTCGCTCACGCCGGCGACATGGTTGACTTCGGTGCGAGAGGTGCCGATG
AGTGAGCGTCGCGAGGCCTCCTTCTCGCTCGCTTTTGCCTTTGCCTCGGATCCGCTGAGCGTCTACCTCCTCGCC
GGTGACGGTTCGAACCTGACGGCCGAGCAGACTTGGGCGCTTCATCTGCGCATCATGTCATGCACCTTCGCCGCC
TATCGGATCCGAGGCATCGTCACCACCATCGGGCCGGACTACGACGCCATAGCCCTATGGACGCCTCCTGGAAAG
TTCATGGACGACTGGTGGGCTACCTTCCGAAGCGGCACTTGGCGTCTCGCCTATCAGTTGCCCGTCGAGGCTCGA
AAGCGCTTCTTCGATGAGCTCGTGCCCGCGCTGCACGATACGCGCGAGAAGACCATGGGCGAGCGAAACAACGAT
ACCTGGTATCTCGGCTATATCGCTACCAAGCCTAGTGCCCGTGGTCGCGGCTACGCTTCCAAGTTGATTCGCGAC
GTGACGCAAAAGGCAGGCTTGACCATCTCAGTCGAAACCCCTTCCCCCCCTTCCCCCCCCCCGGGTGCTGATGCC
GAGAACCGACCCATATATCTCGAGTCGACGTCGGGCAGCAACAACGGCTTCTACGCAAAGTTTGGCTTCGAGACA
AAGTCGCTTATTGAGCTGAAGCGTGGGCCTGTGCCTATCCGGCTGTGTTGTATGGTTCGTGAGCCGCATCCTGTC
CAGCTGCGCGCCTCTGAGACCGAGTCGTCCAACGAGGGCGTCAAAGTCTAG
Gene >Ophio5|3377
ATGAATCCGGCCGGTAGTAAGCCGAGTTGTCCGGAGGCCGAGACGTCGGCCCCGACCGGAGGTTCCTCATCGGCA
GCCCCGTCACGCGACCTAGAAGCGTCGTCGCTCACGCCGGCGACATGGTTGACTTCGGTGCGAGAGGTGCCGATG
AGTGAGCGTCGCGAGGCCTCCTTCTCGCTCGCTTTTGCCTTTGCCTCGGATCCGCTGAGCGTCTACCTCCTCGCC
GGTGACGGTTCGAACCTGACGGCCGAGCAGACTTGGGCGCTTCATCTGCGCATCATGTCATGCACCTTCGCCGCC
TATCGGATCCGAGGCATCGTCACCACCATCGGGCCGGACTACGACGCCATAGCCCTATGGACGCCTCCTGGAAAG
TTCATGGACGACTGGTGGGCTACCTTCCGAAGCGGCACTTGGCGTCTCGCCTATCAGTTGCCCGTCGAGGCTCGA
AAGCGCTTCTTCGATGAGCTCGTGCCCGCGCTGCACGATACGCGCGAGAAGACCATGGGCGAGCGAAACAACGAT
ACCTGGTATCTCGGCTATATCGCTACCAAGCCTAGTGCCCGTGGTCGCGGCTACGCTTCCAAGTTGATTCGCGAC
GTGACGCAAAAGGCAGGCTTGACCATCTCAGTCGAAACCCCTTCCCCCCCTTCCCCCCCCCCGGGTGTCTTCCAT
AGGAACTGACCATGATGCGCAAATCTCCCCCCCCTCCAGGCTGATGCCGAGAACCGACCCATATATCTCGAGTCG
ACGTCGGGCAGCAACAACGGCTTCTACGCAAAGTTTGGCTTCGAGACAAAGTCGCTTATTGAGCTGAAGCGTGGG
CCTGTGCCTATCCGGCTGTGTTGTATGGTTCGTGAGCCGCATCCTGTCCAGCTGCGCGCCTCTGAGACCGAGTCG
TCCAACGAGGGCGTCAAAGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail