Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3376
Gene name
Locationscaffold_268:24383..25814
Strand-
Gene length (bp)1431
Transcript length (bp)1431
Coding sequence length (bp)1428
Protein length (aa) 476

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04127 DFP DNA / pantothenate metabolism flavoprotein 1.9E-05 107 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40506|PPCS_YEAST Phosphopantothenate--cysteine ligase CAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAB2 PE=1 SV=2 70 412 2.0E-79
sp|Q9USK7|YJ2I_SCHPO Uncharacterized protein C4B3.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.18 PE=3 SV=1 76 412 8.0E-65
sp|Q9HAB8|PPCS_HUMAN Phosphopantothenate--cysteine ligase OS=Homo sapiens GN=PPCS PE=1 SV=2 82 400 2.0E-56
sp|Q69S81|PPCS1_ORYSJ Phosphopantothenate--cysteine ligase 1 OS=Oryza sativa subsp. japonica GN=Os02g0575200 PE=2 SV=1 75 408 3.0E-56
sp|Q9LZM3|PPCS2_ARATH Phosphopantothenate--cysteine ligase 2 OS=Arabidopsis thaliana GN=PPCS2 PE=2 SV=2 74 396 4.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40506|PPCS_YEAST Phosphopantothenate--cysteine ligase CAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAB2 PE=1 SV=2 70 412 2.0E-79
sp|Q9USK7|YJ2I_SCHPO Uncharacterized protein C4B3.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.18 PE=3 SV=1 76 412 8.0E-65
sp|Q9HAB8|PPCS_HUMAN Phosphopantothenate--cysteine ligase OS=Homo sapiens GN=PPCS PE=1 SV=2 82 400 2.0E-56
sp|Q69S81|PPCS1_ORYSJ Phosphopantothenate--cysteine ligase 1 OS=Oryza sativa subsp. japonica GN=Os02g0575200 PE=2 SV=1 75 408 3.0E-56
sp|Q9LZM3|PPCS2_ARATH Phosphopantothenate--cysteine ligase 2 OS=Arabidopsis thaliana GN=PPCS2 PE=2 SV=2 74 396 4.0E-56
sp|Q0J7N5|PPCS2_ORYSJ Phosphopantothenate--cysteine ligase 2 OS=Oryza sativa subsp. japonica GN=Os08g0176100 PE=2 SV=2 75 400 3.0E-54
sp|Q8GXR5|PPCS1_ARATH Phosphopantothenate--cysteine ligase 1 OS=Arabidopsis thaliana GN=PPCS1 PE=2 SV=1 74 396 1.0E-52
sp|Q8VDG5|PPCS_MOUSE Phosphopantothenate--cysteine ligase OS=Mus musculus GN=Ppcs PE=1 SV=1 82 400 1.0E-44
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 39 29
2 46 68 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3376
MTEAHAFHAIGLVFFFVAVVVVVVIIIIIIIIIIIVVVIIKNVINILFNLFIFLTFLIFLIIFIVVAMSSTTEAA
YFATTPPPAQLEWLTSRARTFISHHAASGRRVALVTSGGTTVPLERQTVRFIDNFSAGTRGATSAERLLTAGYAV
IFLHRQFSLQPYARHFSHDASGGTGLLDLLETTTDNDDDDDDDDDEKEEEKKKKKKKKKEEKQREVVVRVKKAEA
KNVARVLKHYRAACHDNLLLPLAFVTVGDYLHSLRAVASLMRPLGPRALLYLAAAVSDFFVPPERMAEHKLQSGG
EAVTDDDDDDNNNNNSSSPHPREQQQQQKGRRLVVDLDPVPKFLKSLVDGWAPEGLIVSYKLETDPRMLIAKARA
SLRRYQHHLVIGNLLATRKWEVVFVQPEPSPVRWLRLPAAAAAAAAAAAAAATAAKEVGDEEMPLPLEKLPPGEP
DAEIEALIIPAVAELHDAHIAAFKKP
Coding >Ophio5|3376
ATGACCGAGGCCCACGCATTCCATGCTATTGGTTTGGTTTTTTTTTTCGTTGCCGTCGTCGTCGTCGTTGTCATC
ATCATCATCATCATCATCATCATCATCATCGTCGTCGTCATCATTAAAAACGTCATCAACATCCTCTTCAATCTC
TTCATCTTCCTCACCTTCCTCATCTTCCTCATCATCTTCATCGTCGTCGCCATGTCATCAACCACGGAAGCCGCC
TACTTCGCCACGACGCCTCCACCCGCCCAACTCGAATGGCTGACCTCACGAGCGCGCACCTTCATCTCCCACCAC
GCAGCCAGCGGCCGACGGGTGGCACTCGTAACATCGGGCGGGACGACGGTACCTCTGGAGCGACAAACGGTTCGC
TTCATCGACAACTTCAGCGCCGGAACACGGGGAGCTACGAGCGCAGAGCGACTGCTCACGGCCGGATACGCCGTC
ATCTTCCTCCATCGTCAATTCAGTCTCCAGCCTTACGCTCGACATTTCTCCCACGATGCTAGCGGTGGTACGGGC
CTGCTCGACCTGTTGGAGACGACGACGGATAATGATGATGATGATGATGATGATGATGATGAGAAGGAGGAGGAG
AAGAAGAAGAAGAAGAAGAAGAAGAAAGAGGAAAAGCAGAGGGAGGTGGTGGTCAGGGTCAAGAAGGCGGAAGCC
AAGAATGTCGCTCGCGTTTTGAAGCACTATCGGGCTGCGTGCCATGACAATCTACTCCTGCCGTTGGCCTTTGTC
ACTGTCGGCGATTATCTTCATTCGTTGAGGGCTGTGGCTTCGCTCATGAGGCCCTTGGGACCCAGGGCTTTGCTC
TATCTCGCCGCTGCCGTGTCCGATTTCTTCGTCCCGCCGGAACGAATGGCGGAGCACAAGCTACAATCCGGCGGC
GAAGCCGTAACCGACGACGACGACGACGACAACAACAACAACAACAGCAGCAGTCCTCATCCACGAGAGCAGCAA
CAACAACAAAAAGGCCGTCGTCTCGTCGTCGATCTCGACCCGGTCCCCAAATTCCTCAAAAGCCTCGTCGACGGC
TGGGCTCCCGAAGGCCTCATCGTATCCTACAAGCTAGAAACGGATCCAAGGATGCTCATCGCCAAAGCCCGCGCT
TCCCTACGTCGATACCAGCACCACCTCGTCATAGGGAATCTGCTCGCCACCCGAAAATGGGAGGTGGTCTTCGTC
CAGCCTGAACCCAGCCCTGTGCGTTGGCTTCGTCTTCCTGCTGCTGCTGCTGCTGCTGCTGCCGCTGCTGCTGCC
GCTGCCACTGCCGCCAAGGAAGTTGGTGACGAGGAGATGCCGTTGCCGTTGGAGAAACTACCGCCGGGTGAGCCG
GATGCGGAGATTGAAGCGCTCATCATTCCGGCTGTTGCCGAACTGCATGATGCCCATATTGCTGCTTTCAAAAAA
CCG
Transcript >Ophio5|3376
ATGACCGAGGCCCACGCATTCCATGCTATTGGTTTGGTTTTTTTTTTCGTTGCCGTCGTCGTCGTCGTTGTCATC
ATCATCATCATCATCATCATCATCATCATCGTCGTCGTCATCATTAAAAACGTCATCAACATCCTCTTCAATCTC
TTCATCTTCCTCACCTTCCTCATCTTCCTCATCATCTTCATCGTCGTCGCCATGTCATCAACCACGGAAGCCGCC
TACTTCGCCACGACGCCTCCACCCGCCCAACTCGAATGGCTGACCTCACGAGCGCGCACCTTCATCTCCCACCAC
GCAGCCAGCGGCCGACGGGTGGCACTCGTAACATCGGGCGGGACGACGGTACCTCTGGAGCGACAAACGGTTCGC
TTCATCGACAACTTCAGCGCCGGAACACGGGGAGCTACGAGCGCAGAGCGACTGCTCACGGCCGGATACGCCGTC
ATCTTCCTCCATCGTCAATTCAGTCTCCAGCCTTACGCTCGACATTTCTCCCACGATGCTAGCGGTGGTACGGGC
CTGCTCGACCTGTTGGAGACGACGACGGATAATGATGATGATGATGATGATGATGATGATGAGAAGGAGGAGGAG
AAGAAGAAGAAGAAGAAGAAGAAGAAAGAGGAAAAGCAGAGGGAGGTGGTGGTCAGGGTCAAGAAGGCGGAAGCC
AAGAATGTCGCTCGCGTTTTGAAGCACTATCGGGCTGCGTGCCATGACAATCTACTCCTGCCGTTGGCCTTTGTC
ACTGTCGGCGATTATCTTCATTCGTTGAGGGCTGTGGCTTCGCTCATGAGGCCCTTGGGACCCAGGGCTTTGCTC
TATCTCGCCGCTGCCGTGTCCGATTTCTTCGTCCCGCCGGAACGAATGGCGGAGCACAAGCTACAATCCGGCGGC
GAAGCCGTAACCGACGACGACGACGACGACAACAACAACAACAACAGCAGCAGTCCTCATCCACGAGAGCAGCAA
CAACAACAAAAAGGCCGTCGTCTCGTCGTCGATCTCGACCCGGTCCCCAAATTCCTCAAAAGCCTCGTCGACGGC
TGGGCTCCCGAAGGCCTCATCGTATCCTACAAGCTAGAAACGGATCCAAGGATGCTCATCGCCAAAGCCCGCGCT
TCCCTACGTCGATACCAGCACCACCTCGTCATAGGGAATCTGCTCGCCACCCGAAAATGGGAGGTGGTCTTCGTC
CAGCCTGAACCCAGCCCTGTGCGTTGGCTTCGTCTTCCTGCTGCTGCTGCTGCTGCTGCTGCCGCTGCTGCTGCC
GCTGCCACTGCCGCCAAGGAAGTTGGTGACGAGGAGATGCCGTTGCCGTTGGAGAAACTACCGCCGGGTGAGCCG
GATGCGGAGATTGAAGCGCTCATCATTCCGGCTGTTGCCGAACTGCATGATGCCCATATTGCTGCTTTCAAAAAA
CCGTAA
Gene >Ophio5|3376
ATGACCGAGGCCCACGCATTCCATGCTATTGGTTTGGTTTTTTTTTTCGTTGCCGTCGTCGTCGTCGTTGTCATC
ATCATCATCATCATCATCATCATCATCATCGTCGTCGTCATCATTAAAAACGTCATCAACATCCTCTTCAATCTC
TTCATCTTCCTCACCTTCCTCATCTTCCTCATCATCTTCATCGTCGTCGCCATGTCATCAACCACGGAAGCCGCC
TACTTCGCCACGACGCCTCCACCCGCCCAACTCGAATGGCTGACCTCACGAGCGCGCACCTTCATCTCCCACCAC
GCAGCCAGCGGCCGACGGGTGGCACTCGTAACATCGGGCGGGACGACGGTACCTCTGGAGCGACAAACGGTTCGC
TTCATCGACAACTTCAGCGCCGGAACACGGGGAGCTACGAGCGCAGAGCGACTGCTCACGGCCGGATACGCCGTC
ATCTTCCTCCATCGTCAATTCAGTCTCCAGCCTTACGCTCGACATTTCTCCCACGATGCTAGCGGTGGTACGGGC
CTGCTCGACCTGTTGGAGACGACGACGGATAATGATGATGATGATGATGATGATGATGATGAGAAGGAGGAGGAG
AAGAAGAAGAAGAAGAAGAAGAAGAAAGAGGAAAAGCAGAGGGAGGTGGTGGTCAGGGTCAAGAAGGCGGAAGCC
AAGAATGTCGCTCGCGTTTTGAAGCACTATCGGGCTGCGTGCCATGACAATCTACTCCTGCCGTTGGCCTTTGTC
ACTGTCGGCGATTATCTTCATTCGTTGAGGGCTGTGGCTTCGCTCATGAGGCCCTTGGGACCCAGGGCTTTGCTC
TATCTCGCCGCTGCCGTGTCCGATTTCTTCGTCCCGCCGGAACGAATGGCGGAGCACAAGCTACAATCCGGCGGC
GAAGCCGTAACCGACGACGACGACGACGACAACAACAACAACAACAGCAGCAGTCCTCATCCACGAGAGCAGCAA
CAACAACAAAAAGGCCGTCGTCTCGTCGTCGATCTCGACCCGGTCCCCAAATTCCTCAAAAGCCTCGTCGACGGC
TGGGCTCCCGAAGGCCTCATCGTATCCTACAAGCTAGAAACGGATCCAAGGATGCTCATCGCCAAAGCCCGCGCT
TCCCTACGTCGATACCAGCACCACCTCGTCATAGGGAATCTGCTCGCCACCCGAAAATGGGAGGTGGTCTTCGTC
CAGCCTGAACCCAGCCCTGTGCGTTGGCTTCGTCTTCCTGCTGCTGCTGCTGCTGCTGCTGCCGCTGCTGCTGCC
GCTGCCACTGCCGCCAAGGAAGTTGGTGACGAGGAGATGCCGTTGCCGTTGGAGAAACTACCGCCGGGTGAGCCG
GATGCGGAGATTGAAGCGCTCATCATTCCGGCTGTTGCCGAACTGCATGATGCCCATATTGCTGCTTTCAAAAAA
CCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail