Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3375
Gene name
Locationscaffold_268:21946..23523
Strand+
Gene length (bp)1577
Transcript length (bp)1437
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.9E-36 96 428
PF00083 Sugar_tr Sugar (and other) transporter 1.9E-05 87 193

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 7 465 5.0E-80
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 5 472 1.0E-77
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 43 465 5.0E-27
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 73 452 8.0E-27
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 75 452 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 7 465 5.0E-80
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 5 472 1.0E-77
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 43 465 5.0E-27
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 73 452 8.0E-27
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 75 452 2.0E-25
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 66 466 6.0E-24
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 79 452 2.0E-23
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 76 410 3.0E-23
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 66 477 2.0E-22
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 63 460 6.0E-22
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 79 463 6.0E-22
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 57 468 9.0E-22
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 65 468 2.0E-20
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 65 468 3.0E-20
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 79 472 3.0E-18
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 79 451 1.0E-16
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 79 466 2.0E-16
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 56 278 2.0E-16
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 79 452 2.0E-15
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 79 452 3.0E-15
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 79 472 4.0E-15
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 86 463 6.0E-15
sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1 11 462 8.0E-15
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 79 466 9.0E-15
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 86 465 1.0E-14
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 56 287 2.0E-14
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 86 465 4.0E-14
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 71 465 6.0E-14
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 34 462 1.0E-13
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 34 462 3.0E-13
sp|O15403|MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens GN=SLC16A6 PE=1 SV=2 67 263 2.0E-12
sp|O35308|MOT3_MOUSE Monocarboxylate transporter 3 OS=Mus musculus GN=Slc16a8 PE=2 SV=2 88 338 8.0E-12
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 79 459 1.0E-11
sp|B1AT66|MOT7_MOUSE Monocarboxylate transporter 7 OS=Mus musculus GN=Slc16a6 PE=1 SV=1 67 263 2.0E-11
sp|Q3MHW6|MOT1_BOVIN Monocarboxylate transporter 1 OS=Bos taurus GN=SLC16A1 PE=2 SV=2 79 391 3.0E-11
sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3 79 391 3.0E-11
sp|P53986|MOT1_MOUSE Monocarboxylate transporter 1 OS=Mus musculus GN=Slc16a1 PE=1 SV=1 79 391 4.0E-11
sp|Q03064|MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus GN=SLC16A1 PE=1 SV=1 79 391 2.0E-10
sp|P53987|MOT1_RAT Monocarboxylate transporter 1 OS=Rattus norvegicus GN=Slc16a1 PE=1 SV=1 79 391 2.0E-10
sp|O70461|MOT3_RAT Monocarboxylate transporter 3 OS=Rattus norvegicus GN=Slc16a8 PE=2 SV=1 88 338 5.0E-10
sp|G5E8K6|MOT6_MOUSE Monocarboxylate transporter 6 OS=Mus musculus GN=Slc16a5 PE=3 SV=1 85 342 5.0E-10
sp|O95907|MOT3_HUMAN Monocarboxylate transporter 3 OS=Homo sapiens GN=SLC16A8 PE=2 SV=1 76 338 7.0E-10
sp|Q5ZJU0|MOT9_CHICK Monocarboxylate transporter 9 OS=Gallus gallus GN=SLC16A9 PE=2 SV=1 79 279 4.0E-07
sp|Q7TM99|MOT9_MOUSE Monocarboxylate transporter 9 OS=Mus musculus GN=Slc16a9 PE=2 SV=1 76 279 5.0E-07
sp|O15375|MOT6_HUMAN Monocarboxylate transporter 6 OS=Homo sapiens GN=SLC16A5 PE=2 SV=1 85 242 2.0E-06
sp|Q5R5M4|MOT9_PONAB Monocarboxylate transporter 9 OS=Pongo abelii GN=SLC16A9 PE=2 SV=1 79 279 3.0E-06
sp|Q7RTY1|MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens GN=SLC16A9 PE=1 SV=1 79 279 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 89 111 22
2 126 148 22
3 155 173 18
4 183 205 22
5 212 234 22
6 244 266 22
7 287 309 22
8 322 344 22
9 351 373 22
10 379 401 22
11 414 436 22
12 446 468 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 67.09 36.83 97.34
CcL In ants, during behavior modification 621.88 137.66 1106.10
CcD In ants, recently dead 262.51 121.25 403.78

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.012392 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3375
MDVHQVNSRALHDDDDDSAATTTMTTTTSTAAVAAAAAAVATDDDDDDEAAASVCEDDGADGDALEKRASSASYE
EAYPEGGLRAWLVVLGSWFAMVSSMGLMNTVGIFQAYTLRHQLRHHSEGTVGWIFSTYTFLSFFCGVYIGPVFDK
YGPRWLVVAGCVSTFTGVLLMSFCQELWQFVLSFGVLAGFGTSLLFTPCIAAVGHWFRRRRGFATGMASTAGGIG
GIVFPLMLTSLFDRVGYGWATRALALACLACGLVGVLLVRSRLPPARDATAHPDLRILRQVPFTLTTVAIFLLEF
SLFIPLTFISTYALHRGFDQSFAFHLLPIMNAGSVVGRALPGYYADVVGPFNTCLASVLLSLVACLCVWLPLGHT
AAGIIVFSLVFGFASGTSIAIAPVCIGRMCKTRNYGRYYATTYTVVSFACLLGVPIGGSIVRASNGSYTSLIVLT
GAVYVGSALCMLLAKVWHLGWKRWLAVY
Coding >Ophio5|3375
ATGGACGTACACCAAGTCAACTCTCGCGCGCTGCACGACGACGACGACGACAGCGCGGCCACTACTACGATGACG
ACGACGACGAGTACCGCCGCCGTCGCCGCCGCCGCCGCCGCCGTCGCCACCGACGACGACGACGACGACGAAGCC
GCCGCCTCGGTCTGCGAAGATGATGGCGCCGACGGCGACGCCCTCGAGAAGCGGGCCTCTTCGGCCTCGTACGAA
GAGGCGTACCCCGAAGGCGGCTTGCGCGCCTGGCTTGTCGTCCTCGGCAGCTGGTTCGCCATGGTTTCGTCGATG
GGACTGATGAATACGGTTGGCATCTTTCAGGCGTATACGCTTCGCCACCAGCTACGCCATCATAGTGAGGGCACC
GTCGGATGGATCTTTTCCACCTATACCTTTTTATCCTTCTTTTGTGGTGTCTATATCGGGCCGGTTTTTGACAAG
TATGGGCCGAGGTGGTTGGTTGTTGCTGGCTGTGTGAGCACCTTTACCGGTGTGCTGTTGATGAGTTTCTGTCAA
GAGCTCTGGCAGTTCGTCCTCTCCTTCGGCGTCCTCGCCGGCTTCGGCACCTCGCTCCTCTTCACACCCTGCATC
GCCGCCGTGGGCCACTGGTTCCGGCGTCGACGGGGCTTCGCGACCGGCATGGCGTCGACGGCGGGCGGTATCGGC
GGCATCGTCTTCCCCCTCATGCTCACCTCGCTCTTCGACCGCGTCGGCTACGGCTGGGCAACGCGTGCCCTGGCC
CTGGCCTGTCTGGCTTGCGGCCTCGTGGGCGTGCTTCTGGTGCGATCGCGTCTACCGCCGGCTCGTGACGCGACG
GCCCATCCGGATCTGCGGATTCTTCGTCAGGTGCCCTTTACGCTGACGACGGTGGCCATCTTCCTGCTCGAGTTT
TCGCTCTTCATCCCCTTGACCTTCATCTCGACGTACGCGCTCCACAGGGGCTTCGACCAGTCGTTTGCCTTTCAC
CTGCTGCCCATCATGAACGCCGGCTCCGTCGTCGGCCGCGCTCTTCCGGGCTATTACGCCGACGTGGTCGGTCCC
TTCAACACCTGTCTCGCCTCGGTCCTCCTCTCGCTCGTGGCCTGTCTCTGCGTCTGGCTCCCGCTCGGTCATACG
GCGGCCGGCATCATCGTCTTCTCCCTCGTCTTCGGCTTCGCCAGCGGGACCAGCATCGCCATCGCGCCCGTCTGC
ATCGGACGCATGTGCAAGACGCGCAACTACGGTCGATACTACGCTACCACCTACACCGTCGTCTCCTTTGCCTGC
CTCCTCGGCGTCCCCATCGGCGGATCCATCGTCCGCGCCAGCAACGGCTCCTACACGAGTCTCATCGTCCTCACC
GGCGCCGTCTACGTCGGTTCAGCGCTCTGCATGCTGCTGGCCAAGGTCTGGCATCTGGGCTGGAAGCGGTGGCTG
GCCGTGTAC
Transcript >Ophio5|3375
ATGGACGTACACCAAGTCAACTCTCGCGCGCTGCACGACGACGACGACGACAGCGCGGCCACTACTACGATGACG
ACGACGACGAGTACCGCCGCCGTCGCCGCCGCCGCCGCCGCCGTCGCCACCGACGACGACGACGACGACGAAGCC
GCCGCCTCGGTCTGCGAAGATGATGGCGCCGACGGCGACGCCCTCGAGAAGCGGGCCTCTTCGGCCTCGTACGAA
GAGGCGTACCCCGAAGGCGGCTTGCGCGCCTGGCTTGTCGTCCTCGGCAGCTGGTTCGCCATGGTTTCGTCGATG
GGACTGATGAATACGGTTGGCATCTTTCAGGCGTATACGCTTCGCCACCAGCTACGCCATCATAGTGAGGGCACC
GTCGGATGGATCTTTTCCACCTATACCTTTTTATCCTTCTTTTGTGGTGTCTATATCGGGCCGGTTTTTGACAAG
TATGGGCCGAGGTGGTTGGTTGTTGCTGGCTGTGTGAGCACCTTTACCGGTGTGCTGTTGATGAGTTTCTGTCAA
GAGCTCTGGCAGTTCGTCCTCTCCTTCGGCGTCCTCGCCGGCTTCGGCACCTCGCTCCTCTTCACACCCTGCATC
GCCGCCGTGGGCCACTGGTTCCGGCGTCGACGGGGCTTCGCGACCGGCATGGCGTCGACGGCGGGCGGTATCGGC
GGCATCGTCTTCCCCCTCATGCTCACCTCGCTCTTCGACCGCGTCGGCTACGGCTGGGCAACGCGTGCCCTGGCC
CTGGCCTGTCTGGCTTGCGGCCTCGTGGGCGTGCTTCTGGTGCGATCGCGTCTACCGCCGGCTCGTGACGCGACG
GCCCATCCGGATCTGCGGATTCTTCGTCAGGTGCCCTTTACGCTGACGACGGTGGCCATCTTCCTGCTCGAGTTT
TCGCTCTTCATCCCCTTGACCTTCATCTCGACGTACGCGCTCCACAGGGGCTTCGACCAGTCGTTTGCCTTTCAC
CTGCTGCCCATCATGAACGCCGGCTCCGTCGTCGGCCGCGCTCTTCCGGGCTATTACGCCGACGTGGTCGGTCCC
TTCAACACCTGTCTCGCCTCGGTCCTCCTCTCGCTCGTGGCCTGTCTCTGCGTCTGGCTCCCGCTCGGTCATACG
GCGGCCGGCATCATCGTCTTCTCCCTCGTCTTCGGCTTCGCCAGCGGGACCAGCATCGCCATCGCGCCCGTCTGC
ATCGGACGCATGTGCAAGACGCGCAACTACGGTCGATACTACGCTACCACCTACACCGTCGTCTCCTTTGCCTGC
CTCCTCGGCGTCCCCATCGGCGGATCCATCGTCCGCGCCAGCAACGGCTCCTACACGAGTCTCATCGTCCTCACC
GGCGCCGTCTACGTCGGTTCAGCGCTCTGCATGCTGCTGGCCAAGGTCTGGCATCTGGGCTGGAAGCGGTGGCTG
GCCGTGTACTGA
Gene >Ophio5|3375
ATGGACGTACACCAAGTCAACTCTCGCGCGCTGCACGACGACGACGACGACAGCGCGGCCACTACTACGATGACG
ACGACGACGAGTACCGCCGCCGTCGCCGCCGCCGCCGCCGCCGTCGCCACCGACGACGACGACGACGACGAAGCC
GCCGCCTCGGTCTGCGAAGATGATGGCGCCGACGGCGACGCCCTCGAGAAGCGGGCCTCTTCGGCCTCGTACGAA
GAGGCGTACCCCGAAGGCGGCTTGCGCGCCTGGCTTGTCGTCCTCGGCAGCTGGTTCGCCATGGTTTCGTCGATG
GGACTGATGAATACGGTTGGCATCTTTCAGGCGTATACGCTTCGCCACCAGCTACGCCATCATAGTGAGGGCACC
GTCGGATGGATCTTTTCCACCTATACCTTTTTATCCTTCTTTTGTGGTGTCTATATCGGGCCGGTTTTTGACAAG
TATGGGCCGAGGTGGTTGGTTGTTGCTGGCTGTGTGAGCACCTTTACCGGTGTGCTGTTGATGAGTTTCTGTCAA
GGCGAGTTTTGCCCCTTTTCTCTCTCTCTCTCTCTCTCCTCTCATCACTACTCTCCAACCATTCGACTCCCCTTT
TTAGCTCTCTCTTCGGACTAACACCCTTCTCTTCTCTTCTTCTTCTTCTTCTTCTTCTCCCGACAGAGCTCTGGC
AGTTCGTCCTCTCCTTCGGCGTCCTCGCCGGCTTCGGCACCTCGCTCCTCTTCACACCCTGCATCGCCGCCGTGG
GCCACTGGTTCCGGCGTCGACGGGGCTTCGCGACCGGCATGGCGTCGACGGCGGGCGGTATCGGCGGCATCGTCT
TCCCCCTCATGCTCACCTCGCTCTTCGACCGCGTCGGCTACGGCTGGGCAACGCGTGCCCTGGCCCTGGCCTGTC
TGGCTTGCGGCCTCGTGGGCGTGCTTCTGGTGCGATCGCGTCTACCGCCGGCTCGTGACGCGACGGCCCATCCGG
ATCTGCGGATTCTTCGTCAGGTGCCCTTTACGCTGACGACGGTGGCCATCTTCCTGCTCGAGTTTTCGCTCTTCA
TCCCCTTGACCTTCATCTCGACGTACGCGCTCCACAGGGGCTTCGACCAGTCGTTTGCCTTTCACCTGCTGCCCA
TCATGAACGCCGGCTCCGTCGTCGGCCGCGCTCTTCCGGGCTATTACGCCGACGTGGTCGGTCCCTTCAACACCT
GTCTCGCCTCGGTCCTCCTCTCGCTCGTGGCCTGTCTCTGCGTCTGGCTCCCGCTCGGTCATACGGCGGCCGGCA
TCATCGTCTTCTCCCTCGTCTTCGGCTTCGCCAGCGGGACCAGCATCGCCATCGCGCCCGTCTGCATCGGACGCA
TGTGCAAGACGCGCAACTACGGTCGATACTACGCTACCACCTACACCGTCGTCTCCTTTGCCTGCCTCCTCGGCG
TCCCCATCGGCGGATCCATCGTCCGCGCCAGCAACGGCTCCTACACGAGTCTCATCGTCCTCACCGGCGCCGTCT
ACGTCGGTTCAGCGCTCTGCATGCTGCTGGCCAAGGTCTGGCATCTGGGCTGGAAGCGGTGGCTGGCCGTGTACT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail