Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3375
Gene name
Locationscaffold_268:21946..23523
Strand+
Gene length (bp)1577
Transcript length (bp)1437
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.9E-36 96 428
PF00083 Sugar_tr Sugar (and other) transporter 1.9E-05 87 193

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 7 465 5.0E-80
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 5 472 1.0E-77
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 43 465 5.0E-27
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 73 452 8.0E-27
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 75 452 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 7 465 5.0E-80
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 5 472 1.0E-77
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 43 465 5.0E-27
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 73 452 8.0E-27
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 75 452 2.0E-25
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 66 466 6.0E-24
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 79 452 2.0E-23
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 76 410 3.0E-23
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 66 477 2.0E-22
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 63 460 6.0E-22
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 79 463 6.0E-22
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 57 468 9.0E-22
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 65 468 2.0E-20
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 65 468 3.0E-20
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 79 472 3.0E-18
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 79 451 1.0E-16
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 79 466 2.0E-16
sp|Q8K1C7|MOT14_MOUSE Monocarboxylate transporter 14 OS=Mus musculus GN=Slc16a14 PE=2 SV=1 56 278 2.0E-16
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 79 452 2.0E-15
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 79 452 3.0E-15
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 79 472 4.0E-15
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 86 463 6.0E-15
sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1 11 462 8.0E-15
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 79 466 9.0E-15
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 86 465 1.0E-14
sp|Q7RTX9|MOT14_HUMAN Monocarboxylate transporter 14 OS=Homo sapiens GN=SLC16A14 PE=2 SV=1 56 287 2.0E-14
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 86 465 4.0E-14
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 71 465 6.0E-14
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 34 462 1.0E-13
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 34 462 3.0E-13
sp|O15403|MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens GN=SLC16A6 PE=1 SV=2 67 263 2.0E-12
sp|O35308|MOT3_MOUSE Monocarboxylate transporter 3 OS=Mus musculus GN=Slc16a8 PE=2 SV=2 88 338 8.0E-12
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 79 459 1.0E-11
sp|B1AT66|MOT7_MOUSE Monocarboxylate transporter 7 OS=Mus musculus GN=Slc16a6 PE=1 SV=1 67 263 2.0E-11
sp|Q3MHW6|MOT1_BOVIN Monocarboxylate transporter 1 OS=Bos taurus GN=SLC16A1 PE=2 SV=2 79 391 3.0E-11
sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3 79 391 3.0E-11
sp|P53986|MOT1_MOUSE Monocarboxylate transporter 1 OS=Mus musculus GN=Slc16a1 PE=1 SV=1 79 391 4.0E-11
sp|Q03064|MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus GN=SLC16A1 PE=1 SV=1 79 391 2.0E-10
sp|P53987|MOT1_RAT Monocarboxylate transporter 1 OS=Rattus norvegicus GN=Slc16a1 PE=1 SV=1 79 391 2.0E-10
sp|O70461|MOT3_RAT Monocarboxylate transporter 3 OS=Rattus norvegicus GN=Slc16a8 PE=2 SV=1 88 338 5.0E-10
sp|G5E8K6|MOT6_MOUSE Monocarboxylate transporter 6 OS=Mus musculus GN=Slc16a5 PE=3 SV=1 85 342 5.0E-10
sp|O95907|MOT3_HUMAN Monocarboxylate transporter 3 OS=Homo sapiens GN=SLC16A8 PE=2 SV=1 76 338 7.0E-10
sp|Q5ZJU0|MOT9_CHICK Monocarboxylate transporter 9 OS=Gallus gallus GN=SLC16A9 PE=2 SV=1 79 279 4.0E-07
sp|Q7TM99|MOT9_MOUSE Monocarboxylate transporter 9 OS=Mus musculus GN=Slc16a9 PE=2 SV=1 76 279 5.0E-07
sp|O15375|MOT6_HUMAN Monocarboxylate transporter 6 OS=Homo sapiens GN=SLC16A5 PE=2 SV=1 85 242 2.0E-06
sp|Q5R5M4|MOT9_PONAB Monocarboxylate transporter 9 OS=Pongo abelii GN=SLC16A9 PE=2 SV=1 79 279 3.0E-06
sp|Q7RTY1|MOT9_HUMAN Monocarboxylate transporter 9 OS=Homo sapiens GN=SLC16A9 PE=1 SV=1 79 279 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 89 111 22
2 126 148 22
3 155 173 18
4 183 205 22
5 212 234 22
6 244 266 22
7 287 309 22
8 322 344 22
9 351 373 22
10 379 401 22
11 414 436 22
12 446 468 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3375
MDVHQVNSRALHDDDDDSAATTTMTTTTSTAAVAAAAAAVATDDDDDDEAAASVCEDDGADGDALEKRASSASYE
EAYPEGGLRAWLVVLGSWFAMVSSMGLMNTVGIFQAYTLRHQLRHHSEGTVGWIFSTYTFLSFFCGVYIGPVFDK
YGPRWLVVAGCVSTFTGVLLMSFCQELWQFVLSFGVLAGFGTSLLFTPCIAAVGHWFRRRRGFATGMASTAGGIG
GIVFPLMLTSLFDRVGYGWATRALALACLACGLVGVLLVRSRLPPARDATAHPDLRILRQVPFTLTTVAIFLLEF
SLFIPLTFISTYALHRGFDQSFAFHLLPIMNAGSVVGRALPGYYADVVGPFNTCLASVLLSLVACLCVWLPLGHT
AAGIIVFSLVFGFASGTSIAIAPVCIGRMCKTRNYGRYYATTYTVVSFACLLGVPIGGSIVRASNGSYTSLIVLT
GAVYVGSALCMLLAKVWHLGWKRWLAVY
Coding >Ophio5|3375
ATGGACGTACACCAAGTCAACTCTCGCGCGCTGCACGACGACGACGACGACAGCGCGGCCACTACTACGATGACG
ACGACGACGAGTACCGCCGCCGTCGCCGCCGCCGCCGCCGCCGTCGCCACCGACGACGACGACGACGACGAAGCC
GCCGCCTCGGTCTGCGAAGATGATGGCGCCGACGGCGACGCCCTCGAGAAGCGGGCCTCTTCGGCCTCGTACGAA
GAGGCGTACCCCGAAGGCGGCTTGCGCGCCTGGCTTGTCGTCCTCGGCAGCTGGTTCGCCATGGTTTCGTCGATG
GGACTGATGAATACGGTTGGCATCTTTCAGGCGTATACGCTTCGCCACCAGCTACGCCATCATAGTGAGGGCACC
GTCGGATGGATCTTTTCCACCTATACCTTTTTATCCTTCTTTTGTGGTGTCTATATCGGGCCGGTTTTTGACAAG
TATGGGCCGAGGTGGTTGGTTGTTGCTGGCTGTGTGAGCACCTTTACCGGTGTGCTGTTGATGAGTTTCTGTCAA
GAGCTCTGGCAGTTCGTCCTCTCCTTCGGCGTCCTCGCCGGCTTCGGCACCTCGCTCCTCTTCACACCCTGCATC
GCCGCCGTGGGCCACTGGTTCCGGCGTCGACGGGGCTTCGCGACCGGCATGGCGTCGACGGCGGGCGGTATCGGC
GGCATCGTCTTCCCCCTCATGCTCACCTCGCTCTTCGACCGCGTCGGCTACGGCTGGGCAACGCGTGCCCTGGCC
CTGGCCTGTCTGGCTTGCGGCCTCGTGGGCGTGCTTCTGGTGCGATCGCGTCTACCGCCGGCTCGTGACGCGACG
GCCCATCCGGATCTGCGGATTCTTCGTCAGGTGCCCTTTACGCTGACGACGGTGGCCATCTTCCTGCTCGAGTTT
TCGCTCTTCATCCCCTTGACCTTCATCTCGACGTACGCGCTCCACAGGGGCTTCGACCAGTCGTTTGCCTTTCAC
CTGCTGCCCATCATGAACGCCGGCTCCGTCGTCGGCCGCGCTCTTCCGGGCTATTACGCCGACGTGGTCGGTCCC
TTCAACACCTGTCTCGCCTCGGTCCTCCTCTCGCTCGTGGCCTGTCTCTGCGTCTGGCTCCCGCTCGGTCATACG
GCGGCCGGCATCATCGTCTTCTCCCTCGTCTTCGGCTTCGCCAGCGGGACCAGCATCGCCATCGCGCCCGTCTGC
ATCGGACGCATGTGCAAGACGCGCAACTACGGTCGATACTACGCTACCACCTACACCGTCGTCTCCTTTGCCTGC
CTCCTCGGCGTCCCCATCGGCGGATCCATCGTCCGCGCCAGCAACGGCTCCTACACGAGTCTCATCGTCCTCACC
GGCGCCGTCTACGTCGGTTCAGCGCTCTGCATGCTGCTGGCCAAGGTCTGGCATCTGGGCTGGAAGCGGTGGCTG
GCCGTGTAC
Transcript >Ophio5|3375
ATGGACGTACACCAAGTCAACTCTCGCGCGCTGCACGACGACGACGACGACAGCGCGGCCACTACTACGATGACG
ACGACGACGAGTACCGCCGCCGTCGCCGCCGCCGCCGCCGCCGTCGCCACCGACGACGACGACGACGACGAAGCC
GCCGCCTCGGTCTGCGAAGATGATGGCGCCGACGGCGACGCCCTCGAGAAGCGGGCCTCTTCGGCCTCGTACGAA
GAGGCGTACCCCGAAGGCGGCTTGCGCGCCTGGCTTGTCGTCCTCGGCAGCTGGTTCGCCATGGTTTCGTCGATG
GGACTGATGAATACGGTTGGCATCTTTCAGGCGTATACGCTTCGCCACCAGCTACGCCATCATAGTGAGGGCACC
GTCGGATGGATCTTTTCCACCTATACCTTTTTATCCTTCTTTTGTGGTGTCTATATCGGGCCGGTTTTTGACAAG
TATGGGCCGAGGTGGTTGGTTGTTGCTGGCTGTGTGAGCACCTTTACCGGTGTGCTGTTGATGAGTTTCTGTCAA
GAGCTCTGGCAGTTCGTCCTCTCCTTCGGCGTCCTCGCCGGCTTCGGCACCTCGCTCCTCTTCACACCCTGCATC
GCCGCCGTGGGCCACTGGTTCCGGCGTCGACGGGGCTTCGCGACCGGCATGGCGTCGACGGCGGGCGGTATCGGC
GGCATCGTCTTCCCCCTCATGCTCACCTCGCTCTTCGACCGCGTCGGCTACGGCTGGGCAACGCGTGCCCTGGCC
CTGGCCTGTCTGGCTTGCGGCCTCGTGGGCGTGCTTCTGGTGCGATCGCGTCTACCGCCGGCTCGTGACGCGACG
GCCCATCCGGATCTGCGGATTCTTCGTCAGGTGCCCTTTACGCTGACGACGGTGGCCATCTTCCTGCTCGAGTTT
TCGCTCTTCATCCCCTTGACCTTCATCTCGACGTACGCGCTCCACAGGGGCTTCGACCAGTCGTTTGCCTTTCAC
CTGCTGCCCATCATGAACGCCGGCTCCGTCGTCGGCCGCGCTCTTCCGGGCTATTACGCCGACGTGGTCGGTCCC
TTCAACACCTGTCTCGCCTCGGTCCTCCTCTCGCTCGTGGCCTGTCTCTGCGTCTGGCTCCCGCTCGGTCATACG
GCGGCCGGCATCATCGTCTTCTCCCTCGTCTTCGGCTTCGCCAGCGGGACCAGCATCGCCATCGCGCCCGTCTGC
ATCGGACGCATGTGCAAGACGCGCAACTACGGTCGATACTACGCTACCACCTACACCGTCGTCTCCTTTGCCTGC
CTCCTCGGCGTCCCCATCGGCGGATCCATCGTCCGCGCCAGCAACGGCTCCTACACGAGTCTCATCGTCCTCACC
GGCGCCGTCTACGTCGGTTCAGCGCTCTGCATGCTGCTGGCCAAGGTCTGGCATCTGGGCTGGAAGCGGTGGCTG
GCCGTGTACTGA
Gene >Ophio5|3375
ATGGACGTACACCAAGTCAACTCTCGCGCGCTGCACGACGACGACGACGACAGCGCGGCCACTACTACGATGACG
ACGACGACGAGTACCGCCGCCGTCGCCGCCGCCGCCGCCGCCGTCGCCACCGACGACGACGACGACGACGAAGCC
GCCGCCTCGGTCTGCGAAGATGATGGCGCCGACGGCGACGCCCTCGAGAAGCGGGCCTCTTCGGCCTCGTACGAA
GAGGCGTACCCCGAAGGCGGCTTGCGCGCCTGGCTTGTCGTCCTCGGCAGCTGGTTCGCCATGGTTTCGTCGATG
GGACTGATGAATACGGTTGGCATCTTTCAGGCGTATACGCTTCGCCACCAGCTACGCCATCATAGTGAGGGCACC
GTCGGATGGATCTTTTCCACCTATACCTTTTTATCCTTCTTTTGTGGTGTCTATATCGGGCCGGTTTTTGACAAG
TATGGGCCGAGGTGGTTGGTTGTTGCTGGCTGTGTGAGCACCTTTACCGGTGTGCTGTTGATGAGTTTCTGTCAA
GGCGAGTTTTGCCCCTTTTCTCTCTCTCTCTCTCTCTCCTCTCATCACTACTCTCCAACCATTCGACTCCCCTTT
TTAGCTCTCTCTTCGGACTAACACCCTTCTCTTCTCTTCTTCTTCTTCTTCTTCTTCTCCCGACAGAGCTCTGGC
AGTTCGTCCTCTCCTTCGGCGTCCTCGCCGGCTTCGGCACCTCGCTCCTCTTCACACCCTGCATCGCCGCCGTGG
GCCACTGGTTCCGGCGTCGACGGGGCTTCGCGACCGGCATGGCGTCGACGGCGGGCGGTATCGGCGGCATCGTCT
TCCCCCTCATGCTCACCTCGCTCTTCGACCGCGTCGGCTACGGCTGGGCAACGCGTGCCCTGGCCCTGGCCTGTC
TGGCTTGCGGCCTCGTGGGCGTGCTTCTGGTGCGATCGCGTCTACCGCCGGCTCGTGACGCGACGGCCCATCCGG
ATCTGCGGATTCTTCGTCAGGTGCCCTTTACGCTGACGACGGTGGCCATCTTCCTGCTCGAGTTTTCGCTCTTCA
TCCCCTTGACCTTCATCTCGACGTACGCGCTCCACAGGGGCTTCGACCAGTCGTTTGCCTTTCACCTGCTGCCCA
TCATGAACGCCGGCTCCGTCGTCGGCCGCGCTCTTCCGGGCTATTACGCCGACGTGGTCGGTCCCTTCAACACCT
GTCTCGCCTCGGTCCTCCTCTCGCTCGTGGCCTGTCTCTGCGTCTGGCTCCCGCTCGGTCATACGGCGGCCGGCA
TCATCGTCTTCTCCCTCGTCTTCGGCTTCGCCAGCGGGACCAGCATCGCCATCGCGCCCGTCTGCATCGGACGCA
TGTGCAAGACGCGCAACTACGGTCGATACTACGCTACCACCTACACCGTCGTCTCCTTTGCCTGCCTCCTCGGCG
TCCCCATCGGCGGATCCATCGTCCGCGCCAGCAACGGCTCCTACACGAGTCTCATCGTCCTCACCGGCGCCGTCT
ACGTCGGTTCAGCGCTCTGCATGCTGCTGGCCAAGGTCTGGCATCTGGGCTGGAAGCGGTGGCTGGCCGTGTACT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail