Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|336
Gene name
Locationscaffold_1076:129..1654
Strand+
Gene length (bp)1525
Transcript length (bp)1383
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01566 Nramp Natural resistance-associated macrophage protein 3.9E-89 13 398

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38925|SMF1_YEAST Manganese transporter SMF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMF1 PE=1 SV=2 1 459 3.0E-153
sp|P38778|SMF2_YEAST Manganese transporter SMF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMF2 PE=3 SV=1 1 460 4.0E-140
sp|Q10177|PDT1_SCHPO Manganese transporter pdt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdt1 PE=1 SV=1 1 460 8.0E-134
sp|Q12078|SMF3_YEAST Iron transporter SMF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMF3 PE=1 SV=1 1 458 3.0E-130
sp|Q8ZSB0|MNTH_NOSS1 Divalent metal cation transporter MntH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mntH PE=3 SV=1 1 398 4.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38925|SMF1_YEAST Manganese transporter SMF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMF1 PE=1 SV=2 1 459 3.0E-153
sp|P38778|SMF2_YEAST Manganese transporter SMF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMF2 PE=3 SV=1 1 460 4.0E-140
sp|Q10177|PDT1_SCHPO Manganese transporter pdt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdt1 PE=1 SV=1 1 460 8.0E-134
sp|Q12078|SMF3_YEAST Iron transporter SMF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMF3 PE=1 SV=1 1 458 3.0E-130
sp|Q8ZSB0|MNTH_NOSS1 Divalent metal cation transporter MntH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mntH PE=3 SV=1 1 398 4.0E-81
sp|Q8PKX1|MNTH_XANAC Divalent metal cation transporter MntH OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mntH PE=3 SV=1 1 411 1.0E-80
sp|Q98I99|MNTH_RHILO Divalent metal cation transporter MntH OS=Rhizobium loti (strain MAFF303099) GN=mntH PE=3 SV=1 1 398 1.0E-80
sp|Q89K67|MNTH_BRADU Divalent metal cation transporter MntH OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mntH PE=3 SV=1 1 398 5.0E-79
sp|P65545|MNTH_BRUSU Divalent metal cation transporter MntH OS=Brucella suis biovar 1 (strain 1330) GN=mntH PE=3 SV=1 1 398 2.0E-78
sp|P65544|MNTH_BRUME Divalent metal cation transporter MntH OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mntH PE=3 SV=1 1 398 2.0E-78
sp|Q8UEM1|MNTH_AGRFC Divalent metal cation transporter MntH OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mntH PE=3 SV=1 1 393 2.0E-77
sp|Q8P8R8|MNTH_XANCP Divalent metal cation transporter MntH OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mntH PE=3 SV=1 1 398 4.0E-77
sp|Q92BT1|MNTH_LISIN Divalent metal cation transporter MntH OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mntH PE=3 SV=1 1 398 3.0E-74
sp|Q8Y773|MNTH_LISMO Divalent metal cation transporter MntH OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mntH PE=3 SV=1 1 398 7.0E-74
sp|B8DE85|MNTH_LISMH Divalent metal cation transporter MntH OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=mntH PE=3 SV=1 1 398 7.0E-74
sp|Q71ZP6|MNTH_LISMF Divalent metal cation transporter MntH OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mntH PE=3 SV=1 1 398 7.0E-74
sp|C1L2Y0|MNTH_LISMC Divalent metal cation transporter MntH OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=mntH PE=3 SV=1 1 398 7.0E-74
sp|A0AIM7|MNTH_LISW6 Divalent metal cation transporter MntH OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=mntH PE=3 SV=1 1 398 9.0E-74
sp|Q03D26|MNTH_LACC3 Divalent metal cation transporter MntH OS=Lactobacillus casei (strain ATCC 334) GN=mntH PE=3 SV=1 1 398 2.0E-68
sp|B3W6P3|MNTH_LACCB Divalent metal cation transporter MntH OS=Lactobacillus casei (strain BL23) GN=mntH PE=3 SV=1 1 398 3.0E-68
sp|Q7A166|MNTH_STAAW Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain MW2) GN=mntH PE=3 SV=1 1 398 2.0E-67
sp|Q6GAA9|MNTH_STAAS Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain MSSA476) GN=mntH PE=3 SV=1 1 398 2.0E-67
sp|Q99UZ7|MNTH_STAAN Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain N315) GN=mntH PE=1 SV=1 1 398 2.0E-67
sp|A6QFW1|MNTH_STAAE Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain Newman) GN=mntH PE=3 SV=1 1 398 2.0E-67
sp|Q5HGX9|MNTH_STAAC Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain COL) GN=mntH PE=3 SV=1 1 398 2.0E-67
sp|A5IRZ2|MNTH_STAA9 Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain JH9) GN=mntH PE=3 SV=1 1 398 2.0E-67
sp|Q2G2G3|MNTH_STAA8 Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain NCTC 8325) GN=mntH PE=3 SV=1 1 398 2.0E-67
sp|Q2FHX5|MNTH_STAA3 Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain USA300) GN=mntH PE=3 SV=1 1 398 2.0E-67
sp|A6U0S3|MNTH_STAA2 Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain JH1) GN=mntH PE=3 SV=1 1 398 2.0E-67
sp|Q38UX8|MNTH_LACSS Divalent metal cation transporter MntH OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=mntH PE=3 SV=1 1 398 3.0E-67
sp|Q2YX69|MNTH_STAAB Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=mntH PE=3 SV=1 1 398 3.0E-67
sp|Q931T9|MNTH_STAAM Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mntH PE=3 SV=1 1 398 4.0E-67
sp|A7X111|MNTH_STAA1 Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mntH PE=3 SV=1 1 398 4.0E-67
sp|Q5HQ64|MNTH_STAEQ Divalent metal cation transporter MntH OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mntH PE=3 SV=1 1 398 5.0E-67
sp|Q8CPM6|MNTH_STAES Divalent metal cation transporter MntH OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mntH PE=3 SV=1 1 398 7.0E-67
sp|Q03TH5|MNTH_LACBA Divalent metal cation transporter MntH OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=mntH PE=3 SV=1 1 398 1.0E-64
sp|Q4L5B9|MNTH_STAHJ Divalent metal cation transporter MntH OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mntH PE=3 SV=1 1 398 5.0E-64
sp|Q8GH68|MNTH_LACPL Divalent metal cation transporter MntH OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=mntH PE=3 SV=1 1 398 1.0E-63
sp|Q93V04|MNTH_LACBR Divalent metal cation transporter MntH OS=Lactobacillus brevis GN=mntH PE=2 SV=1 1 398 3.0E-63
sp|Q03DK0|MNTH_PEDPA Divalent metal cation transporter MntH OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=mntH PE=3 SV=1 1 398 6.0E-63
sp|Q6GHY0|MNTH_STAAR Divalent metal cation transporter MntH OS=Staphylococcus aureus (strain MRSA252) GN=mntH PE=3 SV=1 1 398 6.0E-63
sp|Q553K4|NRAM2_DICDI Natural resistance-associated macrophage protein 2 homolog OS=Dictyostelium discoideum GN=nramp2 PE=3 SV=1 1 398 9.0E-62
sp|Q87EJ9|MNTH_XYLFT Divalent metal cation transporter MntH OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mntH PE=3 SV=1 1 398 7.0E-61
sp|Q9RPF2|MNTH2_PSEAE Divalent metal cation transporter MntH 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mntH2 PE=3 SV=2 1 398 2.0E-60
sp|Q9PEL3|MNTH_XYLFA Divalent metal cation transporter MntH OS=Xylella fastidiosa (strain 9a5c) GN=mntH PE=3 SV=1 1 398 2.0E-60
sp|Q49WM9|MNTH_STAS1 Divalent metal cation transporter MntH OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mntH PE=3 SV=1 1 398 3.0E-59
sp|Q653V6|NRAM3_ORYSJ Metal transporter Nramp3 OS=Oryza sativa subsp. japonica GN=NRAMP3 PE=2 SV=1 1 396 8.0E-59
sp|Q9SAH8|NRAM1_ARATH Metal transporter Nramp1 OS=Arabidopsis thaliana GN=NRAMP1 PE=1 SV=1 1 396 9.0E-58
sp|Q9S9N8|NRAM6_ARATH Metal transporter Nramp6 OS=Arabidopsis thaliana GN=NRAMP6 PE=2 SV=2 1 398 1.0E-56
sp|Q8XSF6|MNTH_RALSO Divalent metal cation transporter MntH OS=Ralstonia solanacearum (strain GMI1000) GN=mntH PE=3 SV=1 1 398 3.0E-56
sp|Q9RPF3|MNTH1_PSEAE Divalent metal cation transporter MntH 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mntH1 PE=3 SV=2 1 455 3.0E-55
sp|Q0D7E4|NRAM1_ORYSJ Metal transporter Nramp1 OS=Oryza sativa subsp. japonica GN=NRAMP1 PE=2 SV=1 1 398 8.0E-54
sp|Q8H4H5|NRAM5_ORYSJ Metal transporter Nramp5 OS=Oryza sativa subsp. japonica GN=NRAMP5 PE=2 SV=1 1 398 1.0E-51
sp|Q0BW85|MNTH_GRABC Divalent metal cation transporter MntH OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=mntH PE=3 SV=1 3 398 2.0E-51
sp|Q6ZG85|NRAT1_ORYSJ Metal transporter NRAT1 OS=Oryza sativa subsp. japonica GN=NRAT1 PE=2 SV=1 1 396 3.0E-50
sp|Q0B8F7|MNTH_BURCM Divalent metal cation transporter MntH OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=mntH PE=3 SV=1 3 398 8.0E-50
sp|P96593|MNTH_BACSU Divalent metal cation transporter MntH OS=Bacillus subtilis (strain 168) GN=mntH PE=1 SV=1 3 398 4.0E-49
sp|P49283|MVL_DROME Protein Malvolio OS=Drosophila melanogaster GN=Mvl PE=2 SV=2 1 393 9.0E-48
sp|Q9RTP8|MNTH_DEIRA Divalent metal cation transporter MntH OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=mntH PE=3 SV=1 3 398 3.0E-47
sp|O77741|NRAM1_PIG Natural resistance-associated macrophage protein 1 OS=Sus scrofa GN=SLC11A1 PE=2 SV=1 1 393 6.0E-47
sp|Q869V1|NRAM1_DICDI Metal transporter nramp1 homolog OS=Dictyostelium discoideum GN=nramp1 PE=2 SV=1 1 398 6.0E-47
sp|Q1QZ83|MNTH_CHRSD Divalent metal cation transporter MntH OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mntH PE=3 SV=1 3 398 3.0E-46
sp|A5G348|MNTH_ACICJ Divalent metal cation transporter MntH OS=Acidiphilium cryptum (strain JF-5) GN=mntH PE=3 SV=1 3 398 8.0E-46
sp|A1WR47|MNTH_VEREI Divalent metal cation transporter MntH OS=Verminephrobacter eiseniae (strain EF01-2) GN=mntH PE=3 SV=1 1 398 3.0E-45
sp|Q8R7S2|MNTH_CALS4 Divalent metal cation transporter MntH OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mntH PE=3 SV=1 1 399 3.0E-44
sp|P49279|NRAM1_HUMAN Natural resistance-associated macrophage protein 1 OS=Homo sapiens GN=SLC11A1 PE=2 SV=1 1 398 4.0E-44
sp|Q2QN30|NRAM6_ORYSJ Metal transporter Nramp6 OS=Oryza sativa subsp. japonica GN=NRAMP6 PE=2 SV=1 1 400 3.0E-43
sp|P56436|NRAM1_CEREL Natural resistance-associated macrophage protein 1 OS=Cervus elaphus GN=SLC11A1 PE=2 SV=1 1 393 9.0E-43
sp|Q10Q65|NRAM2_ORYSJ Metal transporter Nramp2 OS=Oryza sativa subsp. japonica GN=NRAMP2 PE=2 SV=1 1 398 1.0E-42
sp|P49280|NRAM1_SHEEP Natural resistance-associated macrophage protein 1 OS=Ovis aries GN=SLC11A1 PE=2 SV=2 1 398 2.0E-42
sp|Q9FN18|NRAM4_ARATH Metal transporter Nramp4 OS=Arabidopsis thaliana GN=NRAMP4 PE=2 SV=1 1 398 3.0E-42
sp|Q27946|NRAM1_BUBBU Natural resistance-associated macrophage protein 1 OS=Bubalus bubalis GN=SLC11A1 PE=2 SV=1 1 393 4.0E-42
sp|P51027|NRAM1_CHICK Natural resistance-associated macrophage protein 1 OS=Gallus gallus GN=SLC11A1 PE=2 SV=1 1 393 6.0E-42
sp|A7N307|MNTH_VIBCB Divalent metal cation transporter MntH OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=mntH PE=3 SV=1 3 398 7.0E-42
sp|Q27981|NRAM1_BOVIN Natural resistance-associated macrophage protein 1 OS=Bos taurus GN=SLC11A1 PE=2 SV=1 1 398 1.0E-41
sp|Q9SNV9|NRAM3_ARATH Metal transporter Nramp3 OS=Arabidopsis thaliana GN=NRAMP3 PE=2 SV=2 1 398 1.0E-41
sp|Q9XT74|NRAM1_CANLF Natural resistance-associated macrophage protein 1 OS=Canis lupus familiaris GN=SLC11A1 PE=2 SV=2 1 398 3.0E-41
sp|Q97TN5|MNTH_CLOAB Divalent metal cation transporter MntH OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=mntH PE=3 SV=1 2 400 4.0E-41
sp|P41251|NRAM1_MOUSE Natural resistance-associated macrophage protein 1 OS=Mus musculus GN=Slc11a1 PE=1 SV=2 1 393 5.0E-41
sp|Q95102|NRAM1_BISBI Natural resistance-associated macrophage protein 1 OS=Bison bison GN=SLC11A1 PE=2 SV=1 1 398 7.0E-41
sp|O54902|NRAM2_RAT Natural resistance-associated macrophage protein 2 OS=Rattus norvegicus GN=Slc11a2 PE=1 SV=1 1 393 7.0E-40
sp|P49282|NRAM2_MOUSE Natural resistance-associated macrophage protein 2 OS=Mus musculus GN=Slc11a2 PE=1 SV=2 1 393 1.0E-39
sp|Q9C6B2|NRAM2_ARATH Metal transporter Nramp2 OS=Arabidopsis thaliana GN=NRAMP2 PE=2 SV=1 1 398 1.0E-39
sp|A0KG66|MNTH_AERHH Divalent metal cation transporter MntH OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=mntH PE=3 SV=1 3 378 2.0E-39
sp|P9WIZ5|MNTH_MYCTU Divalent metal cation transporter MntH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mntH PE=1 SV=1 3 392 2.0E-39
sp|P9WIZ4|MNTH_MYCTO Divalent metal cation transporter MntH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mntH PE=3 SV=1 3 392 2.0E-39
sp|Q0T2A8|MNTH_SHIF8 Divalent metal cation transporter MntH OS=Shigella flexneri serotype 5b (strain 8401) GN=mntH PE=3 SV=1 3 398 4.0E-39
sp|A6TC38|MNTH_KLEP7 Divalent metal cation transporter MntH OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mntH PE=3 SV=1 3 398 7.0E-39
sp|O69443|MNTH_MYCBO Divalent metal cation transporter MntH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mntH PE=3 SV=2 3 392 1.0E-38
sp|Q9SN36|NRAM5_ARATH Metal transporter Nramp5 OS=Arabidopsis thaliana GN=NRAMP5 PE=2 SV=1 1 400 2.0E-38
sp|B5XVU3|MNTH_KLEP3 Divalent metal cation transporter MntH OS=Klebsiella pneumoniae (strain 342) GN=mntH PE=3 SV=1 3 398 2.0E-38
sp|A8A2P6|MNTH_ECOHS Divalent metal cation transporter MntH OS=Escherichia coli O9:H4 (strain HS) GN=mntH PE=3 SV=1 3 398 6.0E-38
sp|Q3YZE0|MNTH_SHISS Divalent metal cation transporter MntH OS=Shigella sonnei (strain Ss046) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|Q31Y80|MNTH_SHIBS Divalent metal cation transporter MntH OS=Shigella boydii serotype 4 (strain Sb227) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B2TWY8|MNTH_SHIB3 Divalent metal cation transporter MntH OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B7LL85|MNTH_ESCF3 Divalent metal cation transporter MntH OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|Q1R8X4|MNTH_ECOUT Divalent metal cation transporter MntH OS=Escherichia coli (strain UTI89 / UPEC) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B1LMI9|MNTH_ECOSM Divalent metal cation transporter MntH OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B6I6U2|MNTH_ECOSE Divalent metal cation transporter MntH OS=Escherichia coli (strain SE11) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B7N5Z2|MNTH_ECOLU Divalent metal cation transporter MntH OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|P0A769|MNTH_ECOLI Divalent metal cation transporter MntH OS=Escherichia coli (strain K12) GN=mntH PE=1 SV=1 3 398 7.0E-38
sp|B1IX71|MNTH_ECOLC Divalent metal cation transporter MntH OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|P0A770|MNTH_ECOL6 Divalent metal cation transporter MntH OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|Q0TF69|MNTH_ECOL5 Divalent metal cation transporter MntH OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|A1ADR7|MNTH_ECOK1 Divalent metal cation transporter MntH OS=Escherichia coli O1:K1 / APEC GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B1X9R3|MNTH_ECODH Divalent metal cation transporter MntH OS=Escherichia coli (strain K12 / DH10B) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|C4ZVS8|MNTH_ECOBW Divalent metal cation transporter MntH OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B7M6R1|MNTH_ECO8A Divalent metal cation transporter MntH OS=Escherichia coli O8 (strain IAI1) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B7MY49|MNTH_ECO81 Divalent metal cation transporter MntH OS=Escherichia coli O81 (strain ED1a) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B7NPS9|MNTH_ECO7I Divalent metal cation transporter MntH OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B5YZU5|MNTH_ECO5E Divalent metal cation transporter MntH OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|P0A771|MNTH_ECO57 Divalent metal cation transporter MntH OS=Escherichia coli O157:H7 GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B7LCE3|MNTH_ECO55 Divalent metal cation transporter MntH OS=Escherichia coli (strain 55989 / EAEC) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B7MH51|MNTH_ECO45 Divalent metal cation transporter MntH OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|A7ZPK2|MNTH_ECO24 Divalent metal cation transporter MntH OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B7UGA0|MNTH_ECO27 Divalent metal cation transporter MntH OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mntH PE=3 SV=1 3 398 7.0E-38
sp|B5RCN6|MNTH_SALG2 Divalent metal cation transporter MntH OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mntH PE=3 SV=1 3 398 1.0E-37
sp|B5R3U1|MNTH_SALEP Divalent metal cation transporter MntH OS=Salmonella enteritidis PT4 (strain P125109) GN=mntH PE=3 SV=1 3 398 1.0E-37
sp|Q9RPF4|MNTH_SALTY Divalent metal cation transporter MntH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mntH PE=1 SV=1 3 398 1.0E-37
sp|C0PZC8|MNTH_SALPC Divalent metal cation transporter MntH OS=Salmonella paratyphi C (strain RKS4594) GN=mntH PE=3 SV=1 3 398 1.0E-37
sp|Q57LU5|MNTH_SALCH Divalent metal cation transporter MntH OS=Salmonella choleraesuis (strain SC-B67) GN=mntH PE=3 SV=1 3 398 1.0E-37
sp|Q8Z4X5|MNTH_SALTI Divalent metal cation transporter MntH OS=Salmonella typhi GN=mntH PE=3 SV=1 3 398 1.0E-37
sp|B4TQE4|MNTH_SALSV Divalent metal cation transporter MntH OS=Salmonella schwarzengrund (strain CVM19633) GN=mntH PE=3 SV=1 3 398 1.0E-37
sp|B5BB80|MNTH_SALPK Divalent metal cation transporter MntH OS=Salmonella paratyphi A (strain AKU_12601) GN=mntH PE=3 SV=1 3 398 1.0E-37
sp|Q5PNF0|MNTH_SALPA Divalent metal cation transporter MntH OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mntH PE=3 SV=1 3 398 1.0E-37
sp|A7MP48|MNTH_CROS8 Divalent metal cation transporter MntH OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mntH PE=3 SV=1 3 398 1.0E-37
sp|B1JFZ6|MNTH_YERPY Divalent metal cation transporter MntH OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mntH PE=3 SV=1 3 398 4.0E-37
sp|Q668N2|MNTH_YERPS Divalent metal cation transporter MntH OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mntH PE=3 SV=1 3 398 4.0E-37
sp|A4TMF6|MNTH_YERPP Divalent metal cation transporter MntH OS=Yersinia pestis (strain Pestoides F) GN=mntH PE=3 SV=1 3 398 4.0E-37
sp|Q1CJV0|MNTH_YERPN Divalent metal cation transporter MntH OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mntH PE=3 SV=1 3 398 4.0E-37
sp|Q8ZCK2|MNTH_YERPE Divalent metal cation transporter MntH OS=Yersinia pestis GN=mntH PE=3 SV=1 3 398 4.0E-37
sp|B2K911|MNTH_YERPB Divalent metal cation transporter MntH OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mntH PE=3 SV=1 3 398 4.0E-37
sp|Q1C5Y6|MNTH_YERPA Divalent metal cation transporter MntH OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mntH PE=3 SV=1 3 398 4.0E-37
sp|A7FGC8|MNTH_YERP3 Divalent metal cation transporter MntH OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mntH PE=3 SV=1 3 398 4.0E-37
sp|Q32DF6|MNTH_SHIDS Divalent metal cation transporter MntH OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mntH PE=3 SV=1 3 398 7.0E-37
sp|Q5QN13|NRAM4_ORYSJ Metal transporter Nramp4 OS=Oryza sativa subsp. japonica GN=NRAMP4 PE=2 SV=1 1 411 1.0E-36
sp|A4WD10|MNTH_ENT38 Divalent metal cation transporter MntH OS=Enterobacter sp. (strain 638) GN=mntH PE=3 SV=1 3 398 2.0E-36
sp|A8ADJ8|MNTH_CITK8 Divalent metal cation transporter MntH OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mntH PE=3 SV=2 3 398 4.0E-36
sp|P49281|NRAM2_HUMAN Natural resistance-associated macrophage protein 2 OS=Homo sapiens GN=SLC11A2 PE=1 SV=2 1 393 8.0E-36
sp|Q492G8|MNTH_BLOPB Divalent metal cation transporter MntH OS=Blochmannia pennsylvanicus (strain BPEN) GN=mntH PE=3 SV=1 3 455 3.0E-35
sp|Q21434|NRAML_CAEEL NRAMP-like transporter smf-1 OS=Caenorhabditis elegans GN=smf-1 PE=3 SV=2 1 398 4.0E-35
sp|C6D9J9|MNTH_PECCP Divalent metal cation transporter MntH OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mntH PE=3 SV=1 3 398 4.0E-35
sp|A1JLC3|MNTH_YERE8 Divalent metal cation transporter MntH OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mntH PE=3 SV=1 3 398 6.0E-35
sp|P70553|NRAM1_RAT Natural resistance-associated macrophage protein 1 OS=Rattus norvegicus GN=Slc11a1 PE=2 SV=3 26 393 1.0E-34
sp|B2VDY7|MNTH_ERWT9 Divalent metal cation transporter MntH OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mntH PE=3 SV=1 3 398 2.0E-34
sp|Q50103|MNTH_MYCLE Divalent metal cation transporter MntH OS=Mycobacterium leprae (strain TN) GN=mntH PE=3 SV=2 3 398 5.0E-29
sp|Q9S814|EIN2_ARATH Ethylene-insensitive protein 2 OS=Arabidopsis thaliana GN=EIN2 PE=1 SV=1 1 401 7.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0030001 metal ion transport Yes
GO:0016020 membrane Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0008324 cation transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0006812 cation transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 23 45 22
2 66 88 22
3 98 120 22
4 133 155 22
5 179 201 22
6 255 277 22
7 297 319 22
8 369 391 22
9 433 455 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|336
MVSVAYIDPGNYATDVAAGASQRFALLFVVLASNLAAILLQSLAARLGTVTGLDLAAMCRARLPRWLNLSLYVLA
EVAIVATDLAEVMGTAVALNLLFPSLPLVAGCAIAVVDVMAVLVFYRPEGNMRGLRAFEALVSVLVVGVVICFAL
QLAMLRGRSNVGDVLRGYLPSSVLVKPQALYQACGILGATVMPHGLYLGSGIVQPRLREFDAAHGLLPPGPGPDP
DDGDTTKTAYVPSLTAVRHALMYSVAELTLLLCTFALFVNSAILIVAGISLYGTPGAADADLWGIHDLLARIVSP
VAGTIFALALLLSGVSAGIVCTIAGQMVCEGALNWRVRPWLRRLITRSISVVPALLISAAVGRKGLATALNASQV
VLSVVLPFISLPLIYFTSRTRFMTVEPGAARYVRDADDQSRAIDSGGLGVDLANSWWVIIMAVFVWLVMAVMNVA
NIVLLAMGKS
Coding >Ophio5|336
ATGGTTTCGGTGGCGTACATCGACCCCGGCAACTACGCCACCGACGTGGCGGCCGGCGCCTCGCAACGTTTCGCC
CTCCTCTTCGTCGTTCTGGCCAGCAATCTGGCGGCGATACTGCTTCAGTCGCTGGCCGCCCGACTCGGAACCGTC
ACGGGGCTAGATCTGGCGGCCATGTGTCGTGCGCGACTACCTCGCTGGTTGAACCTCTCGCTATATGTGCTCGCC
GAGGTGGCTATCGTAGCGACTGACCTAGCAGAGGTTATGGGCACCGCTGTCGCTTTGAACCTTTTGTTTCCCAGC
TTGCCGCTCGTTGCGGGGTGTGCCATCGCCGTGGTCGACGTTATGGCCGTCTTGGTCTTTTACCGGCCCGAGGGC
AATATGCGAGGCTTGCGTGCTTTCGAGGCCTTGGTTAGCGTGCTAGTCGTTGGTGTCGTCATCTGCTTTGCTCTG
CAGCTGGCGATGTTGCGAGGACGAAGCAATGTTGGTGATGTTCTCCGTGGCTATCTACCGTCTTCCGTCCTCGTT
AAACCTCAGGCACTCTACCAGGCTTGCGGCATCCTTGGAGCCACCGTCATGCCTCACGGCCTTTACCTCGGCTCC
GGAATCGTTCAGCCGCGACTGCGCGAGTTTGACGCCGCTCACGGCCTGTTACCGCCCGGTCCGGGGCCTGATCCC
GATGACGGCGACACCACCAAGACGGCCTACGTGCCCTCGCTTACGGCCGTCCGGCACGCGCTCATGTATTCAGTG
GCCGAGCTCACGCTACTGCTTTGCACCTTCGCTCTATTCGTCAACTCGGCCATCCTCATCGTCGCTGGCATCTCG
CTCTACGGCACGCCGGGAGCCGCAGACGCGGACCTCTGGGGCATTCACGACCTGCTAGCCCGCATCGTCTCGCCC
GTCGCCGGCACCATCTTCGCACTGGCCTTGCTGCTATCGGGCGTCTCTGCCGGCATCGTCTGCACTATCGCCGGT
CAGATGGTCTGTGAGGGTGCCCTGAACTGGCGCGTCCGGCCCTGGCTGCGACGTCTCATCACCCGCTCCATCAGC
GTCGTGCCGGCGTTGCTCATCTCCGCTGCCGTTGGCCGAAAGGGGCTGGCTACCGCTCTGAACGCCTCTCAAGTC
GTTCTCAGTGTTGTCTTGCCCTTCATTTCCCTACCGCTCATCTACTTCACCAGCCGCACTCGCTTCATGACGGTC
GAACCCGGTGCTGCTCGCTACGTGCGGGACGCAGATGATCAGAGCAGGGCGATCGACAGCGGCGGCTTGGGCGTC
GACTTGGCCAACTCTTGGTGGGTTATTATCATGGCCGTGTTCGTCTGGCTCGTCATGGCTGTCATGAACGTGGCC
AATATTGTGCTGCTGGCCATGGGAAAGTCG
Transcript >Ophio5|336
ATGGTTTCGGTGGCGTACATCGACCCCGGCAACTACGCCACCGACGTGGCGGCCGGCGCCTCGCAACGTTTCGCC
CTCCTCTTCGTCGTTCTGGCCAGCAATCTGGCGGCGATACTGCTTCAGTCGCTGGCCGCCCGACTCGGAACCGTC
ACGGGGCTAGATCTGGCGGCCATGTGTCGTGCGCGACTACCTCGCTGGTTGAACCTCTCGCTATATGTGCTCGCC
GAGGTGGCTATCGTAGCGACTGACCTAGCAGAGGTTATGGGCACCGCTGTCGCTTTGAACCTTTTGTTTCCCAGC
TTGCCGCTCGTTGCGGGGTGTGCCATCGCCGTGGTCGACGTTATGGCCGTCTTGGTCTTTTACCGGCCCGAGGGC
AATATGCGAGGCTTGCGTGCTTTCGAGGCCTTGGTTAGCGTGCTAGTCGTTGGTGTCGTCATCTGCTTTGCTCTG
CAGCTGGCGATGTTGCGAGGACGAAGCAATGTTGGTGATGTTCTCCGTGGCTATCTACCGTCTTCCGTCCTCGTT
AAACCTCAGGCACTCTACCAGGCTTGCGGCATCCTTGGAGCCACCGTCATGCCTCACGGCCTTTACCTCGGCTCC
GGAATCGTTCAGCCGCGACTGCGCGAGTTTGACGCCGCTCACGGCCTGTTACCGCCCGGTCCGGGGCCTGATCCC
GATGACGGCGACACCACCAAGACGGCCTACGTGCCCTCGCTTACGGCCGTCCGGCACGCGCTCATGTATTCAGTG
GCCGAGCTCACGCTACTGCTTTGCACCTTCGCTCTATTCGTCAACTCGGCCATCCTCATCGTCGCTGGCATCTCG
CTCTACGGCACGCCGGGAGCCGCAGACGCGGACCTCTGGGGCATTCACGACCTGCTAGCCCGCATCGTCTCGCCC
GTCGCCGGCACCATCTTCGCACTGGCCTTGCTGCTATCGGGCGTCTCTGCCGGCATCGTCTGCACTATCGCCGGT
CAGATGGTCTGTGAGGGTGCCCTGAACTGGCGCGTCCGGCCCTGGCTGCGACGTCTCATCACCCGCTCCATCAGC
GTCGTGCCGGCGTTGCTCATCTCCGCTGCCGTTGGCCGAAAGGGGCTGGCTACCGCTCTGAACGCCTCTCAAGTC
GTTCTCAGTGTTGTCTTGCCCTTCATTTCCCTACCGCTCATCTACTTCACCAGCCGCACTCGCTTCATGACGGTC
GAACCCGGTGCTGCTCGCTACGTGCGGGACGCAGATGATCAGAGCAGGGCGATCGACAGCGGCGGCTTGGGCGTC
GACTTGGCCAACTCTTGGTGGGTTATTATCATGGCCGTGTTCGTCTGGCTCGTCATGGCTGTCATGAACGTGGCC
AATATTGTGCTGCTGGCCATGGGAAAGTCGTAG
Gene >Ophio5|336
ATGGTTTCGGTGGCGTACAGTGAGTTTTTCTGTCTTTCTCTCCTCCTCCCTCTTTATCTAGTATGTATTCCTTTC
CTTGTCTGCTGACCTTCATCTTCAAGTCGACCCCGGCAACTACGCCACCGACGTGGCGGCCGGCGCCTCGCAACG
TTTCGCCCTCCTCTTCGTCGTTCTGGCCAGCAATCTGGCGGCGATACTGCTTCAGTCGCTGGCCGCCCGACTCGG
AACCGTCACGGGGCTAGATCTGGCGGCCATGTGTCGTGCGCGACTACCTCGCTGGTTGAACCTCTCGCTATATGT
GCTCGCCGAGGTGGCTATCGTAGCGACTGACCTAGCAGAGGTTATGGGCACCGCTGTCGCTTTGAACCTTTTGTT
TCCCAGCTTGCCGCTCGTTGCGGGGTGTGCCATCGCCGTGGTCGACGTTATGGCCGTCTTGGTCTTTTACCGGCC
CGAGGGCAATATGCGAGGCTTGCGTGCTTTCGAGGCCTTGGTTAGCGTGCTAGTCGTTGGTGTCGTCATCTGCTT
TGCTCTGCAGCTGGCGATGTTGCGAGGACGAAGCAATGTTGGTGATGTTCTCCGTGGCTATCTACCGTCTTCCGT
CCTCGTTAAACCTCAGGCGTATGTTGCCTCTTTCTCGTGTGATTTGTATCAGGGAGCTCAACTGACACTTCCTCG
CAGACTCTACCAGGCTTGCGGCATCCTTGGAGCCACCGTCATGCCTCACGGCCTTTACCTCGGCTCCGGAATCGT
TCAGCCGCGACTGCGCGAGTTTGACGCCGCTCACGGCCTGTTACCGCCCGGTCCGGGGCCTGATCCCGATGACGG
CGACACCACCAAGACGGCCTACGTGCCCTCGCTTACGGCCGTCCGGCACGCGCTCATGTATTCAGTGGCCGAGCT
CACGCTACTGCTTTGCACCTTCGCTCTATTCGTCAACTCGGCCATCCTCATCGTCGCTGGCATCTCGCTCTACGG
CACGCCGGGAGCCGCAGACGCGGACCTCTGGGGCATTCACGACCTGCTAGCCCGCATCGTCTCGCCCGTCGCCGG
CACCATCTTCGCACTGGCCTTGCTGCTATCGGGCGTCTCTGCCGGCATCGTCTGCACTATCGCCGGTCAGATGGT
CTGTGAGGGTGCCCTGAACTGGCGCGTCCGGCCCTGGCTGCGACGTCTCATCACCCGCTCCATCAGCGTCGTGCC
GGCGTTGCTCATCTCCGCTGCCGTTGGCCGAAAGGGGCTGGCTACCGCTCTGAACGCCTCTCAAGTCGTTCTCAG
TGTTGTCTTGCCCTTCATTTCCCTACCGCTCATCTACTTCACCAGCCGCACTCGCTTCATGACGGTCGAACCCGG
TGCTGCTCGCTACGTGCGGGACGCAGATGATCAGAGCAGGGCGATCGACAGCGGCGGCTTGGGCGTCGACTTGGC
CAACTCTTGGTGGGTTATTATCATGGCCGTGTTCGTCTGGCTCGTCATGGCTGTCATGAACGTGGCCAATATTGT
GCTGCTGGCCATGGGAAAGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail