Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3352
Gene name
Locationscaffold_266:8946..9159
Strand-
Gene length (bp)213
Transcript length (bp)213
Coding sequence length (bp)210
Protein length (aa) 70

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 2 62 2.0E-07

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.4631 0.1871 0.652 0.1588 0.3856 0.078 0.1681 0.2217 0.0837 0.1624

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup23
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1466
Ophiocordyceps australis 1348a (Ghana) OphauG2|2796
Ophiocordyceps australis map64 (Brazil) OphauB2|3994
Ophiocordyceps australis map64 (Brazil) OphauB2|591
Ophiocordyceps australis map64 (Brazil) OphauB2|6458
Ophiocordyceps camponoti-floridani Ophcf2|06420
Ophiocordyceps camponoti-floridani Ophcf2|02533
Ophiocordyceps camponoti-floridani Ophcf2|04590
Ophiocordyceps camponoti-floridani Ophcf2|06808
Ophiocordyceps camponoti-rufipedis Ophun1|3755
Ophiocordyceps camponoti-rufipedis Ophun1|2002
Ophiocordyceps camponoti-rufipedis Ophun1|1119
Ophiocordyceps camponoti-rufipedis Ophun1|7502
Ophiocordyceps camponoti-rufipedis Ophun1|4159
Ophiocordyceps kimflemingae Ophio5|2066
Ophiocordyceps kimflemingae Ophio5|3352 (this protein)
Ophiocordyceps kimflemingae Ophio5|360
Ophiocordyceps kimflemingae Ophio5|4122
Ophiocordyceps kimflemingae Ophio5|5606
Ophiocordyceps subramaniannii Hirsu2|7822
Ophiocordyceps subramaniannii Hirsu2|6429
Ophiocordyceps subramaniannii Hirsu2|16
Ophiocordyceps subramaniannii Hirsu2|10639

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3352
MAEQVSKNYGTNSPWLYLNYAAPTQQPLCGYGADNLAFLKKTAAAYDPDAVFQNLMPAGFKVSRANCSFG
Coding >Ophio5|3352
ATGGCTGAGCAAGTGTCGAAAAATTACGGCACAAACTCGCCTTGGCTCTACCTCAACTACGCCGCGCCCACGCAG
CAGCCCCTCTGCGGCTACGGTGCTGACAACTTGGCATTCTTGAAGAAGACGGCGGCCGCTTACGATCCGGATGCC
GTCTTTCAAAACCTCATGCCCGCCGGCTTCAAGGTCAGCAGGGCGAATTGCTCCTTCGGA
Transcript >Ophio5|3352
ATGGCTGAGCAAGTGTCGAAAAATTACGGCACAAACTCGCCTTGGCTCTACCTCAACTACGCCGCGCCCACGCAG
CAGCCCCTCTGCGGCTACGGTGCTGACAACTTGGCATTCTTGAAGAAGACGGCGGCCGCTTACGATCCGGATGCC
GTCTTTCAAAACCTCATGCCCGCCGGCTTCAAGGTCAGCAGGGCGAATTGCTCCTTCGGATAA
Gene >Ophio5|3352
ATGGCTGAGCAAGTGTCGAAAAATTACGGCACAAACTCGCCTTGGCTCTACCTCAACTACGCCGCGCCCACGCAG
CAGCCCCTCTGCGGCTACGGTGCTGACAACTTGGCATTCTTGAAGAAGACGGCGGCCGCTTACGATCCGGATGCC
GTCTTTCAAAACCTCATGCCCGCCGGCTTCAAGGTCAGCAGGGCGAATTGCTCCTTCGGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail