Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|335
Gene name
Locationscaffold_1075:1257..3731
Strand+
Gene length (bp)2474
Transcript length (bp)2349
Coding sequence length (bp)2346
Protein length (aa) 782

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04109 ATG9 Autophagy protein ATG9 4.1E-197 64 553

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLT9|ATG9_ASPFU Autophagy-related protein 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg9 PE=3 SV=1 59 770 0.0E+00
sp|Q875A7|ATG9_PODAS Autophagy-related protein 9 OS=Podospora anserina GN=ATG9 PE=3 SV=1 16 779 0.0E+00
sp|Q5B6U6|ATG9_EMENI Autophagy-related protein 9 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg9 PE=3 SV=1 104 770 0.0E+00
sp|Q0UYL2|ATG9_PHANO Autophagy-related protein 9 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG9 PE=3 SV=1 9 781 0.0E+00
sp|A1DNW0|ATG9_NEOFI Autophagy-related protein 9 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg9 PE=3 SV=1 4 770 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLT9|ATG9_ASPFU Autophagy-related protein 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg9 PE=3 SV=1 59 770 0.0E+00
sp|Q875A7|ATG9_PODAS Autophagy-related protein 9 OS=Podospora anserina GN=ATG9 PE=3 SV=1 16 779 0.0E+00
sp|Q5B6U6|ATG9_EMENI Autophagy-related protein 9 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg9 PE=3 SV=1 104 770 0.0E+00
sp|Q0UYL2|ATG9_PHANO Autophagy-related protein 9 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG9 PE=3 SV=1 9 781 0.0E+00
sp|A1DNW0|ATG9_NEOFI Autophagy-related protein 9 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg9 PE=3 SV=1 4 770 0.0E+00
sp|A7KAM0|ATG9_PENRW Autophagy-related protein 9 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg9 PE=3 SV=1 52 772 0.0E+00
sp|Q1E6Q3|ATG9_COCIM Autophagy-related protein 9 OS=Coccidioides immitis (strain RS) GN=ATG9 PE=3 SV=1 18 750 0.0E+00
sp|A2QLJ9|ATG9_ASPNC Autophagy-related protein 9 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg9 PE=3 SV=1 59 725 0.0E+00
sp|A1CU77|ATG9_ASPCL Autophagy-related protein 9 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg9 PE=3 SV=1 59 770 0.0E+00
sp|Q2UUT6|ATG9_ASPOR Autophagy-related protein 9 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg9 PE=3 SV=1 15 684 0.0E+00
sp|A7ERK1|ATG9_SCLS1 Autophagy-related protein 9 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg9 PE=3 SV=2 18 781 0.0E+00
sp|Q51WZ9|ATG9_MAGO7 Autophagy-related protein 9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG9 PE=3 SV=1 9 770 0.0E+00
sp|Q7S4D7|ATG9_NEUCR Autophagy-related protein 9 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-7 PE=3 SV=1 31 781 0.0E+00
sp|Q6C2F5|ATG9_YARLI Autophagy-related protein 9 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG9 PE=3 SV=1 6 597 2.0E-168
sp|Q75A48|ATG9_ASHGO Autophagy-related protein 9 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG9 PE=3 SV=1 59 593 3.0E-167
sp|A6ZXH8|ATG9_YEAS7 Autophagy-related protein 9 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG9 PE=3 SV=1 57 593 2.0E-160
sp|Q12142|ATG9_YEAST Autophagy-related protein 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG9 PE=1 SV=1 57 593 2.0E-160
sp|Q4P683|ATG9_USTMA Autophagy-related protein 9 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG9 PE=3 SV=1 13 593 2.0E-158
sp|Q6FQT7|ATG9_CANGA Autophagy-related protein 9 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG9 PE=3 SV=1 57 613 4.0E-158
sp|A7TR50|ATG9_VANPO Autophagy-related protein 9 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG9 PE=3 SV=1 57 630 4.0E-154
sp|Q6CT08|ATG9_KLULA Autophagy-related protein 9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG9 PE=3 SV=1 51 593 8.0E-154
sp|O74312|ATG9_SCHPO Autophagy-related protein 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg9 PE=1 SV=1 57 552 1.0E-148
sp|A7KAI7|ATG9_PICAN Autophagy-related protein 9 OS=Pichia angusta GN=ATG9 PE=3 SV=1 60 593 6.0E-143
sp|P0CM40|ATG9_CRYNJ Autophagy-related protein 9 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG9 PE=3 SV=1 60 564 6.0E-143
sp|P0CM41|ATG9_CRYNB Autophagy-related protein 9 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG9 PE=3 SV=1 60 564 6.0E-143
sp|Q6TGJ4|ATG9_CRYGA Autophagy-related protein 9 OS=Cryptococcus gattii GN=ATG9 PE=3 SV=1 85 559 4.0E-138
sp|Q876N4|ATG9_PICPA Autophagy-related protein 9 OS=Komagataella pastoris GN=ATG9 PE=3 SV=1 60 681 5.0E-137
sp|A5DEX5|ATG9_PICGU Autophagy-related protein 9 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG9 PE=3 SV=2 59 608 2.0E-125
sp|Q5ANC9|ATG9_CANAL Autophagy-related protein 9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG9 PE=3 SV=1 59 556 3.0E-114
sp|Q6BW58|ATG9_DEBHA Autophagy-related protein 9 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG9 PE=3 SV=2 59 556 8.0E-114
sp|A3LZS3|ATG9_PICST Autophagy-related protein 9 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG9 PE=3 SV=3 6 556 6.0E-112
sp|Q54NA3|ATG9_DICDI Autophagy-related protein 9 OS=Dictyostelium discoideum GN=atg9 PE=2 SV=1 71 589 5.0E-95
sp|Q8RUS5|ATG9_ARATH Autophagy-related protein 9 OS=Arabidopsis thaliana GN=ATG9 PE=2 SV=1 70 593 2.0E-75
sp|Q3T904|ATG9A_BOVIN Autophagy-related protein 9A OS=Bos taurus GN=ATG9A PE=2 SV=1 60 607 1.0E-69
sp|Q5FWU3|ATG9A_RAT Autophagy-related protein 9A OS=Rattus norvegicus GN=Atg9a PE=1 SV=1 60 607 1.0E-69
sp|Q5RCS0|ATG9A_PONAB Autophagy-related protein 9A OS=Pongo abelii GN=ATG9A PE=2 SV=1 60 607 7.0E-69
sp|Q7Z3C6|ATG9A_HUMAN Autophagy-related protein 9A OS=Homo sapiens GN=ATG9A PE=1 SV=3 60 607 8.0E-69
sp|Q68FE2|ATG9A_MOUSE Autophagy-related protein 9A OS=Mus musculus GN=Atg9a PE=1 SV=1 66 482 5.0E-48
sp|Q6EBV9|ATG9B_MOUSE Autophagy-related protein 9B OS=Mus musculus GN=Atg9b PE=2 SV=2 66 558 1.0E-41
sp|Q674R7|ATG9B_HUMAN Autophagy-related protein 9B OS=Homo sapiens GN=ATG9B PE=2 SV=1 66 558 9.0E-41
[Show less]

GO

GO Term Description Terminal node
GO:0006914 autophagy Yes
GO:0061919 process utilizing autophagic mechanism No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0009056 catabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044248 cellular catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 86 108 22
2 141 163 22
3 316 338 22
4 405 427 22
5 434 453 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 147.00 71.18 222.83
CcL In ants, during behavior modification 113.05 56.65 169.46
CcD In ants, recently dead 89.30 46.41 132.20

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.302593 no
SC16a CcD 0.035742 yes
CcL CcD 0.352301 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|335
MQTNRQTQPPVRRNPTGRLQMQWNVSMAQQHHQQDVLPGSRPAKRPKSFMTGLMASSRREKSLWRWANTSNLDNF
MRDIYQYYEGGGIGCILCSNALWLLETLFVAVLLTFLSQCVDYSVLPRSRSLDQIVVKQCTKKMSGHWNLGIWLY
SFFFIWKSVQYFLEIRRLLQIRDFYLYLLEIPEQDMQTVSWQDIVGRIMTLRDQNPKTATNMPQNVRRFIGSQSK
ERLDAHDIANRLMRKDNYLIAMINKDILNLSLPLPLLRGRQLFSKTMEWYLQYSILDMVFNDSGQVRQDFLRADR
RGLLSQKLKQRFYFAGLLNLVFAPFVFAYVVIVYFFTYYNEYQKDPRLAAARKYTALAEWKFREFNELPHIFYER
LYMSFPFATRYMDQFPKRMTEEVARSIAFMSGAITAVLAVCTVLDSELFLGFEITKDRTVLFYLGLFGSIWAMTR
GIISEDTSVLNPEYALRNVIEYTHYMPDHWQGRLHSFEVKQEFSDLYKMKVVIFLEEVMGIITTPMLLLLSLPKC
SEQIVDFFREFTIHVDGLGYVCSFAVFDFKKGGGAGVQQGGDHDIREDYYSTKHGKMAASYYGFIDNYVINPRTG
IPGHMPPGLRQQFYPPPAFPSLNSPTLAADIQGPHVGRLVESGRARSRVAGLSGNRATSRVGHNIAHASPMASVL
LDPDHQPVAVCLGARSLHNSRRRRAGYHGKGQIIEETAEDRDGDEDPGQGVHGILGESTWETSPGQGLSRDNSAV
NTEEPEAGVLGLIYQLQQTHNQRQHHRRGGVL
Coding >Ophio5|335
ATGCAAACGAACCGACAGACCCAACCACCGGTGAGACGAAATCCAACCGGGCGATTGCAGATGCAATGGAACGTT
TCGATGGCTCAGCAACACCATCAACAAGACGTCTTGCCTGGTTCACGACCCGCTAAGCGCCCCAAATCATTCATG
ACTGGTCTCATGGCGAGTAGTCGTCGAGAGAAATCGCTCTGGAGATGGGCAAACACGTCGAACTTGGATAACTTC
ATGCGAGACATATATCAGTACTACGAAGGAGGTGGCATCGGGTGTATCCTCTGCTCAAATGCCCTCTGGCTTTTG
GAGACATTATTCGTGGCTGTGCTTCTTACGTTCCTCAGTCAATGTGTCGACTATAGCGTGCTGCCTCGCAGCAGG
TCTCTTGATCAAATCGTCGTCAAGCAATGCACCAAGAAGATGTCGGGTCACTGGAACCTGGGAATCTGGCTATAC
TCCTTCTTCTTCATATGGAAGTCCGTGCAATATTTTCTGGAGATCCGGCGACTTCTACAAATCCGCGACTTTTAT
CTTTATCTTCTCGAGATTCCCGAGCAGGATATGCAGACGGTATCATGGCAAGATATTGTGGGTCGGATCATGACG
CTCCGGGATCAAAATCCAAAGACTGCAACGAATATGCCGCAAAACGTGCGACGCTTCATCGGCAGTCAGTCGAAA
GAGAGGCTGGACGCTCACGACATAGCGAACCGGCTTATGCGCAAGGACAACTACCTGATCGCTATGATAAACAAG
GACATTCTCAACCTGTCTCTTCCACTGCCCCTGTTGAGGGGTAGGCAGTTGTTTTCCAAGACGATGGAATGGTAT
CTGCAATACAGCATTCTCGACATGGTGTTTAACGATTCTGGACAGGTCCGACAAGATTTCTTGAGAGCAGATCGC
AGAGGTCTGCTGAGCCAGAAACTTAAGCAGCGGTTTTATTTCGCGGGACTACTGAATCTCGTTTTTGCGCCGTTT
GTATTTGCGTATGTGGTCATTGTATACTTCTTCACCTACTACAACGAATACCAGAAGGACCCGAGACTGGCAGCG
GCCCGAAAATACACTGCGCTGGCAGAGTGGAAATTCCGAGAATTCAATGAGTTGCCGCATATATTCTACGAAAGG
TTATATATGTCGTTCCCATTTGCGACGCGGTACATGGATCAGTTTCCGAAGCGAATGACAGAGGAAGTGGCTCGA
AGCATTGCATTCATGTCAGGGGCAATCACTGCCGTACTTGCAGTGTGCACCGTTCTGGATTCGGAATTGTTCCTC
GGTTTCGAGATCACCAAGGATCGAACAGTGCTCTTCTATCTGGGGCTGTTTGGAAGTATTTGGGCCATGACGCGC
GGGATAATATCGGAGGATACAAGCGTCTTAAATCCCGAGTACGCGCTGCGCAACGTCATCGAATACACGCATTAT
ATGCCGGACCATTGGCAGGGTCGTTTACACAGCTTTGAGGTGAAGCAGGAATTTTCGGATCTCTACAAGATGAAA
GTTGTCATTTTCCTGGAAGAGGTCATGGGGATAATCACGACACCAATGCTCTTGCTGTTATCACTACCCAAGTGC
AGTGAGCAAATTGTCGACTTCTTCCGGGAGTTCACGATACACGTCGACGGATTGGGCTACGTGTGCTCATTTGCC
GTCTTTGATTTCAAGAAAGGTGGCGGCGCGGGGGTACAGCAAGGTGGCGACCATGACATTCGGGAGGACTATTAC
TCGACCAAGCATGGCAAGATGGCTGCATCGTATTATGGCTTTATAGACAACTATGTCATCAATCCCAGGACAGGA
ATACCAGGACATATGCCGCCTGGGCTGCGACAGCAATTCTACCCACCACCGGCGTTTCCAAGTCTTAACTCGCCC
ACGCTAGCTGCAGATATACAGGGCCCACACGTGGGCCGGCTTGTCGAGTCTGGTCGGGCCAGAAGCCGTGTGGCA
GGGCTGAGTGGAAACCGAGCAACTTCACGGGTCGGTCACAACATTGCACACGCATCTCCGATGGCGTCCGTTCTT
CTCGATCCCGACCACCAACCGGTGGCGGTCTGCTTGGGGGCGAGAAGTTTGCACAATTCGCGGCGTCGCCGAGCC
GGCTACCACGGCAAGGGTCAGATAATTGAGGAGACGGCCGAAGACAGAGATGGCGACGAGGATCCGGGTCAAGGG
GTGCATGGAATACTTGGGGAGTCGACATGGGAGACGTCACCGGGTCAGGGCCTTAGCCGCGATAACAGCGCGGTC
AACACAGAAGAGCCGGAAGCAGGGGTTTTAGGGCTAATATACCAGCTACAACAAACGCACAACCAGCGCCAGCAC
CACCGGCGAGGAGGCGTCTTG
Transcript >Ophio5|335
ATGCAAACGAACCGACAGACCCAACCACCGGTGAGACGAAATCCAACCGGGCGATTGCAGATGCAATGGAACGTT
TCGATGGCTCAGCAACACCATCAACAAGACGTCTTGCCTGGTTCACGACCCGCTAAGCGCCCCAAATCATTCATG
ACTGGTCTCATGGCGAGTAGTCGTCGAGAGAAATCGCTCTGGAGATGGGCAAACACGTCGAACTTGGATAACTTC
ATGCGAGACATATATCAGTACTACGAAGGAGGTGGCATCGGGTGTATCCTCTGCTCAAATGCCCTCTGGCTTTTG
GAGACATTATTCGTGGCTGTGCTTCTTACGTTCCTCAGTCAATGTGTCGACTATAGCGTGCTGCCTCGCAGCAGG
TCTCTTGATCAAATCGTCGTCAAGCAATGCACCAAGAAGATGTCGGGTCACTGGAACCTGGGAATCTGGCTATAC
TCCTTCTTCTTCATATGGAAGTCCGTGCAATATTTTCTGGAGATCCGGCGACTTCTACAAATCCGCGACTTTTAT
CTTTATCTTCTCGAGATTCCCGAGCAGGATATGCAGACGGTATCATGGCAAGATATTGTGGGTCGGATCATGACG
CTCCGGGATCAAAATCCAAAGACTGCAACGAATATGCCGCAAAACGTGCGACGCTTCATCGGCAGTCAGTCGAAA
GAGAGGCTGGACGCTCACGACATAGCGAACCGGCTTATGCGCAAGGACAACTACCTGATCGCTATGATAAACAAG
GACATTCTCAACCTGTCTCTTCCACTGCCCCTGTTGAGGGGTAGGCAGTTGTTTTCCAAGACGATGGAATGGTAT
CTGCAATACAGCATTCTCGACATGGTGTTTAACGATTCTGGACAGGTCCGACAAGATTTCTTGAGAGCAGATCGC
AGAGGTCTGCTGAGCCAGAAACTTAAGCAGCGGTTTTATTTCGCGGGACTACTGAATCTCGTTTTTGCGCCGTTT
GTATTTGCGTATGTGGTCATTGTATACTTCTTCACCTACTACAACGAATACCAGAAGGACCCGAGACTGGCAGCG
GCCCGAAAATACACTGCGCTGGCAGAGTGGAAATTCCGAGAATTCAATGAGTTGCCGCATATATTCTACGAAAGG
TTATATATGTCGTTCCCATTTGCGACGCGGTACATGGATCAGTTTCCGAAGCGAATGACAGAGGAAGTGGCTCGA
AGCATTGCATTCATGTCAGGGGCAATCACTGCCGTACTTGCAGTGTGCACCGTTCTGGATTCGGAATTGTTCCTC
GGTTTCGAGATCACCAAGGATCGAACAGTGCTCTTCTATCTGGGGCTGTTTGGAAGTATTTGGGCCATGACGCGC
GGGATAATATCGGAGGATACAAGCGTCTTAAATCCCGAGTACGCGCTGCGCAACGTCATCGAATACACGCATTAT
ATGCCGGACCATTGGCAGGGTCGTTTACACAGCTTTGAGGTGAAGCAGGAATTTTCGGATCTCTACAAGATGAAA
GTTGTCATTTTCCTGGAAGAGGTCATGGGGATAATCACGACACCAATGCTCTTGCTGTTATCACTACCCAAGTGC
AGTGAGCAAATTGTCGACTTCTTCCGGGAGTTCACGATACACGTCGACGGATTGGGCTACGTGTGCTCATTTGCC
GTCTTTGATTTCAAGAAAGGTGGCGGCGCGGGGGTACAGCAAGGTGGCGACCATGACATTCGGGAGGACTATTAC
TCGACCAAGCATGGCAAGATGGCTGCATCGTATTATGGCTTTATAGACAACTATGTCATCAATCCCAGGACAGGA
ATACCAGGACATATGCCGCCTGGGCTGCGACAGCAATTCTACCCACCACCGGCGTTTCCAAGTCTTAACTCGCCC
ACGCTAGCTGCAGATATACAGGGCCCACACGTGGGCCGGCTTGTCGAGTCTGGTCGGGCCAGAAGCCGTGTGGCA
GGGCTGAGTGGAAACCGAGCAACTTCACGGGTCGGTCACAACATTGCACACGCATCTCCGATGGCGTCCGTTCTT
CTCGATCCCGACCACCAACCGGTGGCGGTCTGCTTGGGGGCGAGAAGTTTGCACAATTCGCGGCGTCGCCGAGCC
GGCTACCACGGCAAGGGTCAGATAATTGAGGAGACGGCCGAAGACAGAGATGGCGACGAGGATCCGGGTCAAGGG
GTGCATGGAATACTTGGGGAGTCGACATGGGAGACGTCACCGGGTCAGGGCCTTAGCCGCGATAACAGCGCGGTC
AACACAGAAGAGCCGGAAGCAGGGGTTTTAGGGCTAATATACCAGCTACAACAAACGCACAACCAGCGCCAGCAC
CACCGGCGAGGAGGCGTCTTGTAG
Gene >Ophio5|335
ATGCAAACGAACCGACAGACCCAACCACCGGTGAGACGAAATCCAACCGGGCGATTGCAGATGCAATGGAACGTT
TCGATGGCTCAGCAACACCATCAACAAGACGTCTTGCCTGGTTCACGACCCGCTAAGCGCCCCAAATCATTCATG
ACTGGTCTCATGGCGAGTAGTCGTCGAGAGAAATCGCTCTGGAGATGGGCAAACACGTCGAACTTGGATAACTTC
ATGCGAGACATATATCAGTACTACGAAGGAGGTGGCATCGGGTGTATCCTCTGCTCAAATGCCCTCTGGCTTTTG
TTAGTTCGATCTTAAGTTTGATGTTGACGTGCAGTGCAGCTCGATCTCCTGTGGCTAATAGTGCCATATAGGGAG
ACATTATTCGTGGCTGTGCTTCTTACGTTCCTCAGTCAATGTGTCGACTATAGCGTGCTGCCTCGCAGCAGGTCT
CTTGATCAAATCGTCGTCAAGCAATGCACCAAGAAGATGTCGGGTCACTGGAACCTGGGAATCTGGCTATACTCC
TTCTTCTTCATATGGAAGTCCGTGCAATATTTTCTGGAGATCCGGCGACTTCTACAAATCCGCGACTTTTATCTT
TATCTTCTCGAGATTCCCGAGCAGGATATGCAGACGGTATCATGGCAAGATATTGTGGGTCGGATCATGACGCTC
CGGGATCAAAATCCAAAGACTGCAACGAATATGCCGCAAAACGTGCGACGCTTCATCGGCAGTCAGTCGAAAGAG
AGGCTGGACGCTCACGACATAGCGAACCGGCTTATGCGCAAGGACAACTACCTGATCGCTATGATAAACAAGGAC
ATTCTCAACCTGTCTCTTCCACTGCCCCTGTTGAGGGGTAGGCAGTTGTTTTCCAAGACGATGGAATGGTATCTG
CAATACAGCATTCTCGACATGGTGTTTAACGATTCTGGACAGGTCCGACAAGATTTCTTGAGAGCAGATCGCAGA
GGTCTGCTGAGCCAGAAACTTAAGCAGCGGTTTTATTTCGCGGGACTACTGAATCTCGTTTTTGCGCCGTTTGTA
TTTGCGTATGTGGTCATTGTATACTTCTTCACCTACTACAACGTGAGTCTTTGTCTTACGCAGAAATCTTGGCAT
GGGGTAACACTCTATTATAGGAATACCAGAAGGACCCGAGACTGGCAGCGGCCCGAAAATACACTGCGCTGGCAG
AGTGGAAATTCCGAGAATTCAATGAGTTGCCGCATATATTCTACGAAAGGTTATATATGTCGTTCCCATTTGCGA
CGCGGTACATGGATCAGTTTCCGAAGCGAATGACAGAGGAAGTGGCTCGAAGCATTGCATTCATGTCAGGGGCAA
TCACTGCCGTACTTGCAGTGTGCACCGTTCTGGATTCGGAATTGTTCCTCGGTTTCGAGATCACCAAGGATCGAA
CAGTGCTCTTCTATCTGGGGCTGTTTGGAAGTATTTGGGCCATGACGCGCGGGATAATATCGGAGGATACAAGCG
TCTTAAATCCCGAGTACGCGCTGCGCAACGTCATCGAATACACGCATTATATGCCGGACCATTGGCAGGGTCGTT
TACACAGCTTTGAGGTGAAGCAGGAATTTTCGGATCTCTACAAGATGAAAGTTGTCATTTTCCTGGAAGAGGTCA
TGGGGATAATCACGACACCAATGCTCTTGCTGTTATCACTACCCAAGTGCAGTGAGCAAATTGTCGACTTCTTCC
GGGAGTTCACGATACACGTCGACGGATTGGGCTACGTGTGCTCATTTGCCGTCTTTGATTTCAAGAAAGGTGGCG
GCGCGGGGGTACAGCAAGGTGGCGACCATGACATTCGGGAGGACTATTACTCGACCAAGCATGGCAAGATGGCTG
CATCGTATTATGGCTTTATAGACAACTATGTCATCAATCCCAGGACAGGAATACCAGGACATATGCCGCCTGGGC
TGCGACAGCAATTCTACCCACCACCGGCGTTTCCAAGTCTTAACTCGCCCACGCTAGCTGCAGATATACAGGGCC
CACACGTGGGCCGGCTTGTCGAGTCTGGTCGGGCCAGAAGCCGTGTGGCAGGGCTGAGTGGAAACCGAGCAACTT
CACGGGTCGGTCACAACATTGCACACGCATCTCCGATGGCGTCCGTTCTTCTCGATCCCGACCACCAACCGGTGG
CGGTCTGCTTGGGGGCGAGAAGTTTGCACAATTCGCGGCGTCGCCGAGCCGGCTACCACGGCAAGGGTCAGATAA
TTGAGGAGACGGCCGAAGACAGAGATGGCGACGAGGATCCGGGTCAAGGGGTGCATGGAATACTTGGGGAGTCGA
CATGGGAGACGTCACCGGGTCAGGGCCTTAGCCGCGATAACAGCGCGGTCAACACAGAAGAGCCGGAAGCAGGGG
TTTTAGGGCTAATATACCAGCTACAACAAACGCACAACCAGCGCCAGCACCACCGGCGAGGAGGCGTCTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail