Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3348
Gene name
Locationscaffold_265:23485..26211
Strand-
Gene length (bp)2726
Transcript length (bp)1902
Coding sequence length (bp)1899
Protein length (aa) 633

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04982 HPP HPP family 2.0E-39 83 207

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q55EF8|Y9096_DICDI Transmembrane protein DDB_G0269096 OS=Dictyostelium discoideum GN=DDB_G0269096 PE=4 SV=1 31 211 2.0E-23
sp|Q556Z9|Y3361_DICDI Transmembrane protein DDB_G0273707/DDB_G0273361 OS=Dictyostelium discoideum GN=DDB_G0273707 PE=4 SV=2 41 211 1.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 47 69 22
2 74 96 22
3 109 128 19
4 148 170 22
5 177 199 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3348
MLRHRTWNWDIDRLLNPLLPPPPWARLPYGLSRFLGYRRTKPPPTGNLMPTFWAFIGILVSLLLIAAVTPRVPLF
RAHGVPVIVGSFGAAAVLEFCTIESPLAQPRNAIVGQMVGAVAAIIMAKLFQLSDRFDQVRWVGGALACASATAL
MNLTGTVHPPAGATALLAVVDPRLVALGWLLLPVVMLGCALMLAVALLVNNIERRFPLYWWTAHDLSRTSSEERN
HGDCVSGSGSSGVDDDEETTIGSPPAITHPDAVLPGSQSEIVVRHGRIFLPKHTLSSMSSRAHRGHQVGLAESHG
GQNHVALSGIDPDLQRNLPAVASFSRPLPWPHTGGRAMLLQSLTPAPRRHFECAFAQRQHWGLISLPQRHNSSGM
SQEKTVNKPMQLLSFDSHPGIALPYLEAVSTGIKDLNSQRLPPSARHHMADNFFDNRLRRNAPATCQSSLAFEAC
IPPQKGWHGGSRWLMGDMRLPWLRPCLACTREAGNAISRSCDKSWRKVEKPSPGDQRNFDKACGGMAIFSSQFVR
INEGDDSASCVGLRCVPIRCVRVTLKSRGARSEPETNRLVNHLRRDACLETSHIPAAGLKQFSYARIEGTALVIN
SNILGTLLMGSSQPVDETTGTKPKPFSTATHAF
Coding >Ophio5|3348
ATGCTGCGACATCGGACCTGGAATTGGGACATCGACCGGCTTCTCAACCCGCTGCTACCGCCTCCGCCATGGGCC
CGTCTGCCGTACGGACTGTCGCGCTTCCTGGGCTACCGCCGGACGAAGCCGCCGCCGACGGGTAATCTGATGCCC
ACCTTTTGGGCCTTTATCGGCATCCTCGTCTCACTGCTGCTCATTGCCGCCGTCACGCCGCGTGTTCCGCTGTTT
CGGGCTCATGGCGTACCCGTCATCGTTGGCTCCTTTGGGGCCGCCGCCGTCCTCGAATTCTGCACCATCGAGTCG
CCGCTCGCTCAGCCGCGCAACGCCATCGTCGGACAGATGGTCGGCGCCGTCGCAGCCATCATCATGGCCAAGCTG
TTCCAGCTCAGCGACCGCTTCGACCAAGTCCGCTGGGTGGGCGGCGCCTTGGCCTGCGCCTCGGCCACGGCGCTC
ATGAACCTGACCGGAACCGTTCATCCGCCAGCTGGTGCGACGGCCTTGCTGGCTGTGGTTGATCCGCGTCTCGTC
GCCCTCGGCTGGCTGCTGCTGCCTGTCGTCATGCTCGGTTGCGCTCTGATGCTGGCTGTCGCTCTCCTCGTTAAC
AACATCGAACGTCGCTTCCCGCTGTACTGGTGGACTGCTCATGACCTGTCTCGTACTTCAAGCGAAGAGAGGAAT
CACGGGGATTGTGTCAGCGGCAGCGGCAGCAGTGGTGTTGACGATGACGAGGAGACTACCATCGGCAGCCCGCCG
GCCATCACGCATCCCGACGCCGTCTTGCCCGGCTCGCAGTCCGAGATTGTCGTCCGCCATGGCCGCATCTTCCTT
CCTAAACATACCTTGTCCTCTATGTCTTCCCGTGCCCACCGCGGCCACCAGGTAGGTCTTGCAGAAAGCCACGGC
GGCCAGAACCACGTAGCGCTGTCAGGAATCGATCCTGACCTGCAACGCAACCTCCCGGCGGTTGCCTCGTTCTCT
CGACCCCTCCCCTGGCCCCATACTGGGGGGCGGGCCATGCTCCTGCAAAGCTTAACCCCTGCCCCTCGCCGACAC
TTTGAATGCGCCTTTGCCCAACGACAGCACTGGGGGCTCATCTCTCTGCCGCAAAGACATAACTCATCCGGCATG
AGCCAGGAGAAAACCGTCAACAAGCCAATGCAATTGCTCTCGTTTGATTCCCATCCTGGTATAGCTTTGCCATAC
CTTGAGGCCGTGTCGACGGGGATTAAAGATCTCAATAGCCAGCGCCTCCCTCCCAGCGCCAGACACCACATGGCC
GACAACTTCTTTGACAACCGTCTGAGACGCAACGCTCCCGCCACATGCCAGTCGTCTCTGGCGTTTGAGGCGTGC
ATTCCCCCCCAGAAGGGGTGGCATGGGGGATCGCGGTGGCTGATGGGAGATATGCGCCTCCCTTGGCTACGGCCG
TGTCTCGCTTGCACCCGCGAGGCGGGGAATGCCATTAGCCGCTCGTGCGACAAGAGTTGGAGGAAAGTTGAGAAG
CCGAGCCCCGGCGACCAAAGGAATTTCGACAAAGCGTGCGGCGGCATGGCGATTTTCTCATCTCAGTTTGTTCGT
ATCAACGAGGGAGACGACTCGGCATCGTGTGTCGGTCTTCGATGCGTCCCGATCCGATGTGTTCGCGTCACCTTG
AAGTCTCGTGGCGCTCGTTCAGAGCCCGAGACGAACAGACTCGTCAATCACCTAAGACGAGACGCGTGTCTCGAA
ACAAGTCATATCCCAGCTGCAGGCTTGAAGCAATTCTCATATGCCAGGATTGAAGGAACGGCCTTGGTAATCAAC
TCAAACATACTGGGAACCCTGCTTATGGGCAGCAGCCAGCCTGTCGACGAGACAACGGGCACAAAGCCAAAGCCG
TTTTCGACCGCAACACATGCTTTT
Transcript >Ophio5|3348
ATGCTGCGACATCGGACCTGGAATTGGGACATCGACCGGCTTCTCAACCCGCTGCTACCGCCTCCGCCATGGGCC
CGTCTGCCGTACGGACTGTCGCGCTTCCTGGGCTACCGCCGGACGAAGCCGCCGCCGACGGGTAATCTGATGCCC
ACCTTTTGGGCCTTTATCGGCATCCTCGTCTCACTGCTGCTCATTGCCGCCGTCACGCCGCGTGTTCCGCTGTTT
CGGGCTCATGGCGTACCCGTCATCGTTGGCTCCTTTGGGGCCGCCGCCGTCCTCGAATTCTGCACCATCGAGTCG
CCGCTCGCTCAGCCGCGCAACGCCATCGTCGGACAGATGGTCGGCGCCGTCGCAGCCATCATCATGGCCAAGCTG
TTCCAGCTCAGCGACCGCTTCGACCAAGTCCGCTGGGTGGGCGGCGCCTTGGCCTGCGCCTCGGCCACGGCGCTC
ATGAACCTGACCGGAACCGTTCATCCGCCAGCTGGTGCGACGGCCTTGCTGGCTGTGGTTGATCCGCGTCTCGTC
GCCCTCGGCTGGCTGCTGCTGCCTGTCGTCATGCTCGGTTGCGCTCTGATGCTGGCTGTCGCTCTCCTCGTTAAC
AACATCGAACGTCGCTTCCCGCTGTACTGGTGGACTGCTCATGACCTGTCTCGTACTTCAAGCGAAGAGAGGAAT
CACGGGGATTGTGTCAGCGGCAGCGGCAGCAGTGGTGTTGACGATGACGAGGAGACTACCATCGGCAGCCCGCCG
GCCATCACGCATCCCGACGCCGTCTTGCCCGGCTCGCAGTCCGAGATTGTCGTCCGCCATGGCCGCATCTTCCTT
CCTAAACATACCTTGTCCTCTATGTCTTCCCGTGCCCACCGCGGCCACCAGGTAGGTCTTGCAGAAAGCCACGGC
GGCCAGAACCACGTAGCGCTGTCAGGAATCGATCCTGACCTGCAACGCAACCTCCCGGCGGTTGCCTCGTTCTCT
CGACCCCTCCCCTGGCCCCATACTGGGGGGCGGGCCATGCTCCTGCAAAGCTTAACCCCTGCCCCTCGCCGACAC
TTTGAATGCGCCTTTGCCCAACGACAGCACTGGGGGCTCATCTCTCTGCCGCAAAGACATAACTCATCCGGCATG
AGCCAGGAGAAAACCGTCAACAAGCCAATGCAATTGCTCTCGTTTGATTCCCATCCTGGTATAGCTTTGCCATAC
CTTGAGGCCGTGTCGACGGGGATTAAAGATCTCAATAGCCAGCGCCTCCCTCCCAGCGCCAGACACCACATGGCC
GACAACTTCTTTGACAACCGTCTGAGACGCAACGCTCCCGCCACATGCCAGTCGTCTCTGGCGTTTGAGGCGTGC
ATTCCCCCCCAGAAGGGGTGGCATGGGGGATCGCGGTGGCTGATGGGAGATATGCGCCTCCCTTGGCTACGGCCG
TGTCTCGCTTGCACCCGCGAGGCGGGGAATGCCATTAGCCGCTCGTGCGACAAGAGTTGGAGGAAAGTTGAGAAG
CCGAGCCCCGGCGACCAAAGGAATTTCGACAAAGCGTGCGGCGGCATGGCGATTTTCTCATCTCAGTTTGTTCGT
ATCAACGAGGGAGACGACTCGGCATCGTGTGTCGGTCTTCGATGCGTCCCGATCCGATGTGTTCGCGTCACCTTG
AAGTCTCGTGGCGCTCGTTCAGAGCCCGAGACGAACAGACTCGTCAATCACCTAAGACGAGACGCGTGTCTCGAA
ACAAGTCATATCCCAGCTGCAGGCTTGAAGCAATTCTCATATGCCAGGATTGAAGGAACGGCCTTGGTAATCAAC
TCAAACATACTGGGAACCCTGCTTATGGGCAGCAGCCAGCCTGTCGACGAGACAACGGGCACAAAGCCAAAGCCG
TTTTCGACCGCAACACATGCTTTTTGA
Gene >Ophio5|3348
ATGCTGCGACATCGGACCTGGAATTGGGACATCGACCGGCTTCTCAACCCGCTGCTACCGCCTCCGCCATGGGCC
CGTCTGCCGTACGGACTGTCGCGCTTCCTGGGCTACCGCCGGACGAAGCCGCCGCCGACGGGTAATCTGATGCCC
ACCTTTTGGGCCTTTATCGGCATCCTCGTCTCACTGCTGCTCATTGCCGCCGTCACGCCGCGTGTTCCGCTGTTT
CGGGCTCATGGCGTACCCGTCATCGTTGGCTCCTTTGTACGTCTTCTTTCTCGATCCCCCCCCTTTCCTCAGCGG
AAGCAAATAAAAAAGGTAAAATCAACGCCGGAGGGTGAAGAAAGCATCAAGGAAAATGGGCTTGCTTCAGAGGAG
ACCAAAGGGAAAAATGAAAAAAAAAAAACGTATAATAACATCAAGTCAAAAAAAAAAAACATCATGAAAAGGGGG
CCGCCGCCGTCCTCGAATTCTGCACCATCGAGTCGCCGCTCGCTCAGCCGCGCAACGCCATCGTCGGACAGATGG
TCGGCGCCGTCGCAGCCATCATCATGGCCAAGCTGTTCCAGCTCAGCGACCGCTTCGACCAAGTCCGCTGGGTGG
GCGGCGCCTTGGCCTGCGCCTCGGCCACGGCGCTCATGAACCTGACCGGAACCGTTCATCCGCCAGCTGGTGCGA
CGGCCTTGCTGGCTGTGGTTGATCCGCGTCTCGTCGCCCTCGGCTGGCTGCTGCTGCCTGTCGTCATGCTCGGTT
GCGCTCTGATGCTGGCTGTCGCTCTCCTCGTTAACAACATCGAACGTCGCTTCCCGCTGTACTGGTGGACTGCTC
ATGACCTGTCTCGTACTTCAAGCGAAGAGAGGAATCACGGGGATTGTGTCAGCGGCAGCGGCAGCAGTGGTGTTG
ACGATGACGAGGAGACTACCATCGGCAGCCCGCCGGCCATCACGCATCCCGACGCCGTCTTGCCCGGCTCGCAGT
CCGAGATTGTCGTCCGCCATGGCCGCATCTTCCTTCCTAAACATGTCAGTCTGTCGGTCGAGGAGGAGAGAGTAC
TAAACTTCATGAGCCAAAGACTGTGACTAAGACCCCCTTTCACGGAGAAGCCTGGGCAGGTCGGATGCGAGCAAT
GTGGTTGCGGCTCTCATCATCGACGCTCAAGTGTGTACTTGGATAGGAAGGTAGCTAACAGACCTTGTCCTCTAT
GTCTTCCCGTGCCCACCGCGGCCACCAGGTAGGTCTTGCAGAAAGCCACGGCGGCCAGAACCACGTAGCGCTGTC
AGGAATCGATCCTGACCTGCAACGCAACCTCCCGGCGGTTGCCTCGTTCTCTCGACCCCTCCCCTGGCCCCATAC
TGGGGGGCGGGCCATGCTCCTGCAAAGCTTAACCCCTGCCCCTCGCCGACACTTTGAATGCGCCTTTGCCCAACG
ACAGCACTGGGGGCTCATCTCTCTGCCGCAAAGACATAACTCATCCGGCATGAGCCAGGAGAAAACCGTCAACAA
GCCAATGCAATTGCTCTCGTTTGATTCCCATCCTGGTATAGCTTTGCCATACCTTGAGGCCGTGTCGACGGGGAT
TAAAGGTTAGTAATACTGTAGCAATCATCTGCACTGAAAGACGACCAGACACGGAGACGATTGCCTGCTTCGGTG
AGTTACATCGAAGCCGGCAGATCACTGCCCCCTCGTTGCCCCGGACACGGCCGACAGCTCGTCGTACAATACGTT
GCCTTCTCTTGCGCTCTTTGCCTTGCTGACCTTGTGCAGATCTCAATAGCCAGCGCCTCCCTCCCAGCGCCAGAC
ACCACATGGCCGACAACTTCTTTGACAACCGTCTGAGACGCAACGCTCCCGCCACATGCCAGTCGTCTCTGGCGT
TTGAGGCGTGCATTCCCCCCCAGAAGGGGTGGCATGGGGGATCGCGGTGGCTGATGGGAGATATGCGCCTCCCTT
GGCTACGGCCGTGTCTCGCTTGCACCCGCGAGGCGGGGAATGCCATTAGCCGGTAAGAAGGGAACCGCGAGAGAG
TCTGTCAAGGAAAAAGACCCCACAAGGACTCCTCTTGGTTGCGTGTAAATGGCAGCAAGCAAGAGACGCTTGTAG
CTACACTTGATAGCTCGTGCGACAAGAGTTGGAGGAAAGTTGAGAAGCCGAGCCCCGGCGACCAAAGGAATTTCG
ACAAAGCGTGCGGCGGCATGGCGATTTTCTCATCTCAGTTTGTTCGTATCAACGAGGGAGACGACTCGGCATCGT
GTGTCGGTCTTCGATGCGTCCCGATCCGATGTGTTCGCGTCACCTTGAAGTCTCGTGGCGCTCGTTCAGAGCCCG
AGACGAACAGACTCGTCAATCACCTAAGACGAGACGCGTGTCTCGAAACAAGTCATATCCCAGCTGCAGGCTTGA
AGCAATTCTCATATGCCAGGATTGAAGTGAGTCAGAGGCTGGAGCGCCTTCGCCGAGCTCGGTCATGGCTAGAAA
CCCAAAATACTGTCACATGGAAAGGGCCAGACGCGGGCGAGAAGCCGATCGTGACTGACAGAAGCTTCACGGCAG
GGAACGGCCTTGGTAATCAACTCAAACATGTCGGTAATCGACTTATGTGAAGCGCCGAGGGCCAAGCTTTGCGAC
AAGTCAGACTGGGAACCCTGCTTATGGGCAGCAGCCAGCCTGTCGACGAGACAACGGGCACAAAGCCAAAGCCGT
TTTCGACCGCAACACATGCTTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail