Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3345
Gene name
Locationscaffold_265:15939..18627
Strand-
Gene length (bp)2688
Transcript length (bp)2688
Coding sequence length (bp)2685
Protein length (aa) 895

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06738 ThrE Putative threonine/serine exporter 3.7E-71 406 648
PF12821 ThrE_2 Threonine/Serine exporter, ThrE 7.6E-07 672 740

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14267|YFPC_SCHPO Uncharacterized UPF0442 protein C7D4.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC7D4.12c PE=3 SV=1 260 895 6.0E-159
sp|C4YTQ0|PRM10_CANAW Pheromone-regulated membrane protein 10 OS=Candida albicans (strain WO-1) GN=CAWG_05545 PE=3 SV=1 378 895 8.0E-146
sp|Q5AH11|PRM10_CANAL Pheromone-regulated membrane protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRM10 PE=3 SV=1 378 895 8.0E-146
sp|Q6BVE3|PRM10_DEBHA Pheromone-regulated membrane protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2C03278g PE=3 SV=2 260 895 4.0E-144
sp|Q6C4Q0|PRM10_YARLI Pheromone-regulated membrane protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E24651g PE=3 SV=1 392 895 3.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14267|YFPC_SCHPO Uncharacterized UPF0442 protein C7D4.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC7D4.12c PE=3 SV=1 260 895 6.0E-159
sp|C4YTQ0|PRM10_CANAW Pheromone-regulated membrane protein 10 OS=Candida albicans (strain WO-1) GN=CAWG_05545 PE=3 SV=1 378 895 8.0E-146
sp|Q5AH11|PRM10_CANAL Pheromone-regulated membrane protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRM10 PE=3 SV=1 378 895 8.0E-146
sp|Q6BVE3|PRM10_DEBHA Pheromone-regulated membrane protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2C03278g PE=3 SV=2 260 895 4.0E-144
sp|Q6C4Q0|PRM10_YARLI Pheromone-regulated membrane protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E24651g PE=3 SV=1 392 895 3.0E-136
sp|Q6FT92|PRM10_CANGA Pheromone-regulated membrane protein 10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0G04433g PE=3 SV=1 262 895 3.0E-134
sp|C5E109|PRM10_ZYGRC Pheromone-regulated membrane protein 10 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0G17116g PE=3 SV=1 259 739 3.0E-133
sp|Q754J7|PRM10_ASHGO Pheromone-regulated membrane protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AFR075C PE=3 SV=1 266 743 2.0E-130
sp|Q9UVG5|PRM10_PICSO Pheromone-regulated membrane protein 10 OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=GNLVRS01_PISO0A10120g PE=3 SV=2 387 739 2.0E-126
sp|Q6CLI2|PRM10_KLULA Pheromone-regulated membrane protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F02816g PE=3 SV=1 266 739 2.0E-125
sp|A6ZQL9|PRM10_YEAS7 Pheromone-regulated membrane protein 10 OS=Saccharomyces cerevisiae (strain YJM789) GN=PRM10 PE=3 SV=1 262 743 5.0E-125
sp|P87293|YDN1_SCHPO Uncharacterized UPF0442 protein C16A10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16A10.01 PE=3 SV=1 384 739 1.0E-85
sp|P42946|PRM10_YEAST Pheromone-regulated membrane protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRM10 PE=1 SV=1 448 741 3.0E-85
sp|P42947|YJK7_YEAST Uncharacterized UPF0442 protein YJL107C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL107C PE=1 SV=1 388 441 1.0E-20
sp|Q6CLI2|PRM10_KLULA Pheromone-regulated membrane protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F02816g PE=3 SV=1 804 895 2.0E-18
sp|C5E109|PRM10_ZYGRC Pheromone-regulated membrane protein 10 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0G17116g PE=3 SV=1 799 895 1.0E-16
sp|Q754J7|PRM10_ASHGO Pheromone-regulated membrane protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AFR075C PE=3 SV=1 799 895 2.0E-16
sp|A6ZQL9|PRM10_YEAS7 Pheromone-regulated membrane protein 10 OS=Saccharomyces cerevisiae (strain YJM789) GN=PRM10 PE=3 SV=1 804 895 1.0E-15
sp|Q9UVG5|PRM10_PICSO Pheromone-regulated membrane protein 10 OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=GNLVRS01_PISO0A10120g PE=3 SV=2 799 895 1.0E-14
sp|P42946|PRM10_YEAST Pheromone-regulated membrane protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRM10 PE=1 SV=1 804 894 1.0E-14
sp|P87293|YDN1_SCHPO Uncharacterized UPF0442 protein C16A10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16A10.01 PE=3 SV=1 807 892 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

Domain # Start End Length
1 512 531 19
2 538 556 18
3 560 582 22
4 589 611 22
5 626 648 22
6 669 688 19
7 692 714 22
8 800 822 22
9 864 886 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3345
MAGEPTSSSSQASDVPTPNRKTKKRVGWHSSSNSGGGGVDSGGNDGSASRSPLISPERPLPANPPGAPDAHELVL
ALTKVLSDKREQQQEERQWQQIPLISEPPPVATTPPKAPRPALRRNTSYDAPEEREKADQAEQRATQRQLRSLTD
ARQRADRLAISVVRDSAPVSRRNSNDLDATFQPLMDDPDDVDVEGPMSEVVASPDSGLEATPLTPHCRRRNIASE
DHFSAESLVRSHTLRDKARDLFHRKHSSPGPQTPVQEAQDYVPRPSRYRGGILSSLLKLYNDDRGAGGGSNNSSG
HTTPTSPATPLMSPRPSPPPSRPASTAGGPRVRSGAGLFGSHRALNSTASLSELIKSSSMLAAPITGEIHDQWAD
KIRREKPQRSSRKERARITVHIAGIISRHRYLLKLCRALMMYGAPTHRLEEYLTMSARVLEIEGQFLYIPSCMLV
SFDDSTTHTTEVKVVRVPQGIDLGKLRDVHNIYKDVVHDKLGVEEATRRLDEVMQRKPKFHTWLRVPVYGIASAC
VAPFAFEGRFIDLPIAFILGCIVGLLQLVFAPSNELYAHVFEVSAAVITSFLARGFGSIQQGNLFCFSALAQSSI
ALILPGYMVLCSSLELQSHNIVAGSVRMVHAMIYTLFLGYGITIGASLYGMMDKNATSDTHCRDPLSRPWYFVFV
PGFTLCLCILNQAKWRQTPTMTFMALAGFCVNSYCSIYFEQNTQISNMLGALTIGILANLYSRLGRHIHNYWLDV
VEWWEYRMRPRFGKRRPAECADNWSIPSLSDPESRPASPEKPPYRQPRKVGYSLAAAAMLPAIFVQVPSGLAAGG
SLLAGVTSANALNGNPEVLANSSRMGGIDSTAFNVLFSVIQVAIGISVGLFMSALIVYPLGKRRSGLFSF
Coding >Ophio5|3345
ATGGCGGGAGAGCCAACCAGCAGCAGCAGCCAGGCTAGCGACGTGCCTACGCCCAATCGCAAAACCAAGAAGCGT
GTGGGCTGGCACTCGAGCAGCAATAGCGGCGGAGGAGGTGTCGACAGTGGAGGGAATGACGGGAGCGCCTCCAGA
TCGCCGCTCATCTCGCCCGAGCGCCCGCTCCCAGCCAACCCCCCGGGCGCTCCAGACGCCCATGAGCTGGTTCTG
GCCCTTACAAAGGTTCTCTCGGACAAGCGGGAACAGCAGCAGGAAGAGCGTCAGTGGCAGCAGATCCCCCTCATA
TCGGAGCCGCCGCCTGTTGCCACCACCCCCCCCAAGGCTCCGAGGCCGGCTCTGAGACGTAACACCAGCTACGAT
GCGCCCGAGGAACGCGAAAAGGCGGACCAGGCGGAGCAGCGAGCCACCCAGCGTCAGCTCCGCTCCCTGACTGAC
GCACGCCAACGGGCGGATCGACTGGCCATATCAGTGGTCAGGGACTCTGCCCCGGTCTCGAGGCGGAACTCGAAT
GACCTAGACGCTACATTCCAACCCTTGATGGATGATCCAGATGATGTCGACGTCGAGGGCCCGATGAGTGAAGTC
GTTGCCTCTCCCGACTCGGGGCTGGAGGCCACGCCTCTCACGCCCCACTGTCGTCGACGTAATATCGCCTCGGAA
GACCACTTCAGCGCCGAGTCACTTGTCCGGTCTCACACTCTGAGGGACAAGGCCCGCGACTTATTCCATCGCAAA
CACTCTTCCCCCGGCCCTCAGACGCCCGTCCAAGAGGCTCAAGACTACGTCCCCCGCCCGTCACGCTATCGCGGC
GGCATCCTGTCCTCGCTGCTCAAGCTCTACAACGATGATAGAGGCGCCGGCGGTGGCAGCAACAACAGCAGCGGC
CACACAACGCCTACCTCGCCCGCAACGCCTCTCATGTCGCCCCGTCCGTCGCCGCCGCCGTCGCGTCCGGCCTCG
ACGGCGGGAGGCCCCCGGGTCCGCAGCGGCGCCGGCCTGTTTGGCAGCCACCGCGCCCTCAACTCGACGGCATCA
CTGTCGGAGCTCATCAAGTCGTCGTCGATGCTGGCCGCCCCGATTACAGGCGAGATCCATGACCAGTGGGCGGAC
AAGATCAGGAGGGAGAAGCCGCAGCGGTCGAGCAGGAAGGAACGCGCGCGCATCACGGTCCACATTGCCGGCATC
ATCTCTCGACACCGATACCTGCTGAAGCTGTGCCGTGCCCTGATGATGTACGGCGCCCCGACGCACCGGCTCGAG
GAGTACTTGACCATGTCGGCGCGCGTGCTCGAGATTGAGGGCCAGTTCCTCTACATCCCCTCTTGCATGCTCGTC
AGCTTCGATGACAGCACCACTCATACGACCGAGGTCAAGGTGGTCCGCGTGCCTCAGGGCATCGACCTGGGCAAG
CTCCGCGATGTCCACAACATATACAAGGACGTGGTTCACGACAAGCTGGGCGTCGAGGAGGCGACGCGCCGTCTC
GACGAGGTCATGCAGCGCAAGCCCAAGTTTCACACCTGGCTCCGCGTTCCCGTCTATGGGATTGCCTCGGCCTGC
GTCGCGCCCTTTGCCTTTGAGGGTCGCTTCATTGACCTACCCATCGCCTTCATCCTCGGCTGCATCGTCGGTCTG
CTGCAGCTCGTCTTCGCGCCCAGCAACGAGCTCTACGCCCACGTCTTCGAGGTGTCGGCCGCCGTCATCACATCC
TTTCTCGCCCGCGGCTTCGGCTCCATCCAACAGGGCAACCTCTTCTGCTTTAGCGCCCTGGCTCAGAGCAGTATC
GCCCTCATCCTCCCCGGCTACATGGTACTGTGCAGCTCGCTCGAGCTCCAGAGCCACAACATTGTCGCCGGCAGC
GTGCGCATGGTCCACGCCATGATCTACACCCTCTTCCTCGGCTATGGTATCACCATCGGCGCCTCCCTGTACGGC
ATGATGGACAAGAACGCCACGAGCGACACGCACTGCCGCGATCCCCTGTCGCGACCGTGGTACTTCGTCTTCGTC
CCGGGCTTCACCCTGTGTCTATGCATCCTCAACCAGGCCAAATGGCGGCAGACGCCCACCATGACCTTTATGGCT
CTCGCCGGCTTCTGCGTCAACAGCTACTGCAGCATCTATTTCGAACAGAACACGCAAATCTCCAACATGCTGGGT
GCGCTGACGATTGGCATCCTGGCGAATCTGTACTCGCGGCTGGGACGTCACATTCATAACTACTGGCTGGACGTT
GTGGAGTGGTGGGAGTACAGGATGCGGCCCCGGTTCGGCAAGCGACGGCCGGCCGAGTGTGCTGATAATTGGTCC
ATTCCGTCGCTGTCGGATCCTGAGTCTCGGCCTGCTTCGCCGGAGAAGCCGCCATACCGCCAGCCGCGAAAGGTC
GGATACAGCCTCGCCGCGGCCGCCATGCTCCCGGCCATCTTCGTCCAGGTGCCCTCGGGCCTCGCCGCCGGCGGG
TCGCTTCTGGCGGGCGTCACGTCGGCCAACGCGCTTAATGGCAACCCGGAGGTCCTGGCCAACTCTTCGAGGATG
GGTGGCATAGACAGCACGGCTTTCAATGTTCTCTTCAGCGTCATCCAGGTGGCCATTGGCATTAGCGTCGGTCTG
TTCATGAGCGCCCTGATTGTGTATCCGCTCGGGAAGAGGAGAAGCGGCCTGTTCAGCTTC
Transcript >Ophio5|3345
ATGGCGGGAGAGCCAACCAGCAGCAGCAGCCAGGCTAGCGACGTGCCTACGCCCAATCGCAAAACCAAGAAGCGT
GTGGGCTGGCACTCGAGCAGCAATAGCGGCGGAGGAGGTGTCGACAGTGGAGGGAATGACGGGAGCGCCTCCAGA
TCGCCGCTCATCTCGCCCGAGCGCCCGCTCCCAGCCAACCCCCCGGGCGCTCCAGACGCCCATGAGCTGGTTCTG
GCCCTTACAAAGGTTCTCTCGGACAAGCGGGAACAGCAGCAGGAAGAGCGTCAGTGGCAGCAGATCCCCCTCATA
TCGGAGCCGCCGCCTGTTGCCACCACCCCCCCCAAGGCTCCGAGGCCGGCTCTGAGACGTAACACCAGCTACGAT
GCGCCCGAGGAACGCGAAAAGGCGGACCAGGCGGAGCAGCGAGCCACCCAGCGTCAGCTCCGCTCCCTGACTGAC
GCACGCCAACGGGCGGATCGACTGGCCATATCAGTGGTCAGGGACTCTGCCCCGGTCTCGAGGCGGAACTCGAAT
GACCTAGACGCTACATTCCAACCCTTGATGGATGATCCAGATGATGTCGACGTCGAGGGCCCGATGAGTGAAGTC
GTTGCCTCTCCCGACTCGGGGCTGGAGGCCACGCCTCTCACGCCCCACTGTCGTCGACGTAATATCGCCTCGGAA
GACCACTTCAGCGCCGAGTCACTTGTCCGGTCTCACACTCTGAGGGACAAGGCCCGCGACTTATTCCATCGCAAA
CACTCTTCCCCCGGCCCTCAGACGCCCGTCCAAGAGGCTCAAGACTACGTCCCCCGCCCGTCACGCTATCGCGGC
GGCATCCTGTCCTCGCTGCTCAAGCTCTACAACGATGATAGAGGCGCCGGCGGTGGCAGCAACAACAGCAGCGGC
CACACAACGCCTACCTCGCCCGCAACGCCTCTCATGTCGCCCCGTCCGTCGCCGCCGCCGTCGCGTCCGGCCTCG
ACGGCGGGAGGCCCCCGGGTCCGCAGCGGCGCCGGCCTGTTTGGCAGCCACCGCGCCCTCAACTCGACGGCATCA
CTGTCGGAGCTCATCAAGTCGTCGTCGATGCTGGCCGCCCCGATTACAGGCGAGATCCATGACCAGTGGGCGGAC
AAGATCAGGAGGGAGAAGCCGCAGCGGTCGAGCAGGAAGGAACGCGCGCGCATCACGGTCCACATTGCCGGCATC
ATCTCTCGACACCGATACCTGCTGAAGCTGTGCCGTGCCCTGATGATGTACGGCGCCCCGACGCACCGGCTCGAG
GAGTACTTGACCATGTCGGCGCGCGTGCTCGAGATTGAGGGCCAGTTCCTCTACATCCCCTCTTGCATGCTCGTC
AGCTTCGATGACAGCACCACTCATACGACCGAGGTCAAGGTGGTCCGCGTGCCTCAGGGCATCGACCTGGGCAAG
CTCCGCGATGTCCACAACATATACAAGGACGTGGTTCACGACAAGCTGGGCGTCGAGGAGGCGACGCGCCGTCTC
GACGAGGTCATGCAGCGCAAGCCCAAGTTTCACACCTGGCTCCGCGTTCCCGTCTATGGGATTGCCTCGGCCTGC
GTCGCGCCCTTTGCCTTTGAGGGTCGCTTCATTGACCTACCCATCGCCTTCATCCTCGGCTGCATCGTCGGTCTG
CTGCAGCTCGTCTTCGCGCCCAGCAACGAGCTCTACGCCCACGTCTTCGAGGTGTCGGCCGCCGTCATCACATCC
TTTCTCGCCCGCGGCTTCGGCTCCATCCAACAGGGCAACCTCTTCTGCTTTAGCGCCCTGGCTCAGAGCAGTATC
GCCCTCATCCTCCCCGGCTACATGGTACTGTGCAGCTCGCTCGAGCTCCAGAGCCACAACATTGTCGCCGGCAGC
GTGCGCATGGTCCACGCCATGATCTACACCCTCTTCCTCGGCTATGGTATCACCATCGGCGCCTCCCTGTACGGC
ATGATGGACAAGAACGCCACGAGCGACACGCACTGCCGCGATCCCCTGTCGCGACCGTGGTACTTCGTCTTCGTC
CCGGGCTTCACCCTGTGTCTATGCATCCTCAACCAGGCCAAATGGCGGCAGACGCCCACCATGACCTTTATGGCT
CTCGCCGGCTTCTGCGTCAACAGCTACTGCAGCATCTATTTCGAACAGAACACGCAAATCTCCAACATGCTGGGT
GCGCTGACGATTGGCATCCTGGCGAATCTGTACTCGCGGCTGGGACGTCACATTCATAACTACTGGCTGGACGTT
GTGGAGTGGTGGGAGTACAGGATGCGGCCCCGGTTCGGCAAGCGACGGCCGGCCGAGTGTGCTGATAATTGGTCC
ATTCCGTCGCTGTCGGATCCTGAGTCTCGGCCTGCTTCGCCGGAGAAGCCGCCATACCGCCAGCCGCGAAAGGTC
GGATACAGCCTCGCCGCGGCCGCCATGCTCCCGGCCATCTTCGTCCAGGTGCCCTCGGGCCTCGCCGCCGGCGGG
TCGCTTCTGGCGGGCGTCACGTCGGCCAACGCGCTTAATGGCAACCCGGAGGTCCTGGCCAACTCTTCGAGGATG
GGTGGCATAGACAGCACGGCTTTCAATGTTCTCTTCAGCGTCATCCAGGTGGCCATTGGCATTAGCGTCGGTCTG
TTCATGAGCGCCCTGATTGTGTATCCGCTCGGGAAGAGGAGAAGCGGCCTGTTCAGCTTCTAG
Gene >Ophio5|3345
ATGGCGGGAGAGCCAACCAGCAGCAGCAGCCAGGCTAGCGACGTGCCTACGCCCAATCGCAAAACCAAGAAGCGT
GTGGGCTGGCACTCGAGCAGCAATAGCGGCGGAGGAGGTGTCGACAGTGGAGGGAATGACGGGAGCGCCTCCAGA
TCGCCGCTCATCTCGCCCGAGCGCCCGCTCCCAGCCAACCCCCCGGGCGCTCCAGACGCCCATGAGCTGGTTCTG
GCCCTTACAAAGGTTCTCTCGGACAAGCGGGAACAGCAGCAGGAAGAGCGTCAGTGGCAGCAGATCCCCCTCATA
TCGGAGCCGCCGCCTGTTGCCACCACCCCCCCCAAGGCTCCGAGGCCGGCTCTGAGACGTAACACCAGCTACGAT
GCGCCCGAGGAACGCGAAAAGGCGGACCAGGCGGAGCAGCGAGCCACCCAGCGTCAGCTCCGCTCCCTGACTGAC
GCACGCCAACGGGCGGATCGACTGGCCATATCAGTGGTCAGGGACTCTGCCCCGGTCTCGAGGCGGAACTCGAAT
GACCTAGACGCTACATTCCAACCCTTGATGGATGATCCAGATGATGTCGACGTCGAGGGCCCGATGAGTGAAGTC
GTTGCCTCTCCCGACTCGGGGCTGGAGGCCACGCCTCTCACGCCCCACTGTCGTCGACGTAATATCGCCTCGGAA
GACCACTTCAGCGCCGAGTCACTTGTCCGGTCTCACACTCTGAGGGACAAGGCCCGCGACTTATTCCATCGCAAA
CACTCTTCCCCCGGCCCTCAGACGCCCGTCCAAGAGGCTCAAGACTACGTCCCCCGCCCGTCACGCTATCGCGGC
GGCATCCTGTCCTCGCTGCTCAAGCTCTACAACGATGATAGAGGCGCCGGCGGTGGCAGCAACAACAGCAGCGGC
CACACAACGCCTACCTCGCCCGCAACGCCTCTCATGTCGCCCCGTCCGTCGCCGCCGCCGTCGCGTCCGGCCTCG
ACGGCGGGAGGCCCCCGGGTCCGCAGCGGCGCCGGCCTGTTTGGCAGCCACCGCGCCCTCAACTCGACGGCATCA
CTGTCGGAGCTCATCAAGTCGTCGTCGATGCTGGCCGCCCCGATTACAGGCGAGATCCATGACCAGTGGGCGGAC
AAGATCAGGAGGGAGAAGCCGCAGCGGTCGAGCAGGAAGGAACGCGCGCGCATCACGGTCCACATTGCCGGCATC
ATCTCTCGACACCGATACCTGCTGAAGCTGTGCCGTGCCCTGATGATGTACGGCGCCCCGACGCACCGGCTCGAG
GAGTACTTGACCATGTCGGCGCGCGTGCTCGAGATTGAGGGCCAGTTCCTCTACATCCCCTCTTGCATGCTCGTC
AGCTTCGATGACAGCACCACTCATACGACCGAGGTCAAGGTGGTCCGCGTGCCTCAGGGCATCGACCTGGGCAAG
CTCCGCGATGTCCACAACATATACAAGGACGTGGTTCACGACAAGCTGGGCGTCGAGGAGGCGACGCGCCGTCTC
GACGAGGTCATGCAGCGCAAGCCCAAGTTTCACACCTGGCTCCGCGTTCCCGTCTATGGGATTGCCTCGGCCTGC
GTCGCGCCCTTTGCCTTTGAGGGTCGCTTCATTGACCTACCCATCGCCTTCATCCTCGGCTGCATCGTCGGTCTG
CTGCAGCTCGTCTTCGCGCCCAGCAACGAGCTCTACGCCCACGTCTTCGAGGTGTCGGCCGCCGTCATCACATCC
TTTCTCGCCCGCGGCTTCGGCTCCATCCAACAGGGCAACCTCTTCTGCTTTAGCGCCCTGGCTCAGAGCAGTATC
GCCCTCATCCTCCCCGGCTACATGGTACTGTGCAGCTCGCTCGAGCTCCAGAGCCACAACATTGTCGCCGGCAGC
GTGCGCATGGTCCACGCCATGATCTACACCCTCTTCCTCGGCTATGGTATCACCATCGGCGCCTCCCTGTACGGC
ATGATGGACAAGAACGCCACGAGCGACACGCACTGCCGCGATCCCCTGTCGCGACCGTGGTACTTCGTCTTCGTC
CCGGGCTTCACCCTGTGTCTATGCATCCTCAACCAGGCCAAATGGCGGCAGACGCCCACCATGACCTTTATGGCT
CTCGCCGGCTTCTGCGTCAACAGCTACTGCAGCATCTATTTCGAACAGAACACGCAAATCTCCAACATGCTGGGT
GCGCTGACGATTGGCATCCTGGCGAATCTGTACTCGCGGCTGGGACGTCACATTCATAACTACTGGCTGGACGTT
GTGGAGTGGTGGGAGTACAGGATGCGGCCCCGGTTCGGCAAGCGACGGCCGGCCGAGTGTGCTGATAATTGGTCC
ATTCCGTCGCTGTCGGATCCTGAGTCTCGGCCTGCTTCGCCGGAGAAGCCGCCATACCGCCAGCCGCGAAAGGTC
GGATACAGCCTCGCCGCGGCCGCCATGCTCCCGGCCATCTTCGTCCAGGTGCCCTCGGGCCTCGCCGCCGGCGGG
TCGCTTCTGGCGGGCGTCACGTCGGCCAACGCGCTTAATGGCAACCCGGAGGTCCTGGCCAACTCTTCGAGGATG
GGTGGCATAGACAGCACGGCTTTCAATGTTCTCTTCAGCGTCATCCAGGTGGCCATTGGCATTAGCGTCGGTCTG
TTCATGAGCGCCCTGATTGTGTATCCGCTCGGGAAGAGGAGAAGCGGCCTGTTCAGCTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail