Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3343
Gene name
Locationscaffold_265:12620..13228
Strand-
Gene length (bp)608
Transcript length (bp)540
Coding sequence length (bp)537
Protein length (aa) 179

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 9.27 1.87 16.66
CcL In ants, during behavior modification 88.74 39.06 138.42
CcD In ants, recently dead 134.77 69.80 199.74

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.125829 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3343
MSSRLLPSCPALLVPSTNTALSLSLSLSLLLLTSSACNLSIPLPARLHELRSSSPAQLHSINPCRSRESNPQAMR
TSALVFHLSLTQIVFGISVQSPPSNRQFRKHFKPMNSRGGSPPSMEFAPRAVPIYAPDPEICITYSDCPWCTGSN
FGRSRCCLKGLDTPIRICTCGTGNGRHCT
Coding >Ophio5|3343
ATGTCATCGCGATTGCTGCCATCTTGTCCGGCTCTTCTTGTACCGTCAACAAATACAGCTCTTTCTCTCTCTCTC
TCTCTCTCTCTGCTTCTCCTCACCTCTTCTGCCTGCAACCTCAGCATTCCTCTTCCCGCCCGTCTTCACGAGTTA
CGGTCTTCATCTCCAGCACAGCTTCACTCTATCAACCCTTGCCGCAGCCGAGAATCAAATCCGCAGGCCATGCGG
ACTTCGGCCTTGGTCTTCCACCTCTCTCTGACGCAGATCGTCTTCGGCATATCAGTCCAATCTCCTCCTTCAAAT
CGTCAATTTCGAAAACATTTCAAACCTATGAACTCTAGGGGAGGCTCCCCACCATCCATGGAATTCGCTCCTAGA
GCCGTCCCTATTTATGCCCCTGATCCCGAAATTTGCATTACCTATTCAGATTGTCCTTGGTGCACGGGCTCGAAC
TTTGGTCGTTCCAGATGCTGCTTGAAAGGCCTTGATACACCGATACGCATCTGCACCTGCGGCACCGGCAATGGA
AGACACTGTACG
Transcript >Ophio5|3343
ATGTCATCGCGATTGCTGCCATCTTGTCCGGCTCTTCTTGTACCGTCAACAAATACAGCTCTTTCTCTCTCTCTC
TCTCTCTCTCTGCTTCTCCTCACCTCTTCTGCCTGCAACCTCAGCATTCCTCTTCCCGCCCGTCTTCACGAGTTA
CGGTCTTCATCTCCAGCACAGCTTCACTCTATCAACCCTTGCCGCAGCCGAGAATCAAATCCGCAGGCCATGCGG
ACTTCGGCCTTGGTCTTCCACCTCTCTCTGACGCAGATCGTCTTCGGCATATCAGTCCAATCTCCTCCTTCAAAT
CGTCAATTTCGAAAACATTTCAAACCTATGAACTCTAGGGGAGGCTCCCCACCATCCATGGAATTCGCTCCTAGA
GCCGTCCCTATTTATGCCCCTGATCCCGAAATTTGCATTACCTATTCAGATTGTCCTTGGTGCACGGGCTCGAAC
TTTGGTCGTTCCAGATGCTGCTTGAAAGGCCTTGATACACCGATACGCATCTGCACCTGCGGCACCGGCAATGGA
AGACACTGTACGTAG
Gene >Ophio5|3343
ATGTCATCGCGATTGCTGCCATCTTGTCCGGCTCTTCTTGTACCGTCAACAAATACAGCTCTTTCTCTCTCTCTC
TCTCTCTCTCTGCTTCTCCTCACCTCTTCTGCCTGCAACCTCAGCATTCCTCTTCCCGCCCGTCTTCACGAGTTA
CGGTCTTCATCTCCAGCACAGCTTCACTCTATCAACCCTTGCCGCAGCCGAGAATCAAATCCGCAGGCCATGCGG
ACTTCGGCCTTGGTCTTCCACCTCTCTCTGACGCAGATCGTCTTCGGCATATGTAGGAGCAACCGGTCGTCAAAA
CCCGAAAAGTCGGCGGATACTAACTCACCAAACTCTTTTCTCCAGCAGTCCAATCTCCTCCTTCAAATCGTCAAT
TTCGAAAACATTTCAAACCTATGAACTCTAGGGGAGGCTCCCCACCATCCATGGAATTCGCTCCTAGAGCCGTCC
CTATTTATGCCCCTGATCCCGAAATTTGCATTACCTATTCAGATTGTCCTTGGTGCACGGGCTCGAACTTTGGTC
GTTCCAGATGCTGCTTGAAAGGCCTTGATACACCGATACGCATCTGCACCTGCGGCACCGGCAATGGAAGACACT
GTACGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail