Protein ID | Ophio5|3342 |
Gene name | |
Location | scaffold_265:11523..12291 |
Strand | + |
Gene length (bp) | 768 |
Transcript length (bp) | 699 |
Coding sequence length (bp) | 696 |
Protein length (aa) | 232 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF01174 | SNO | SNO glutamine amidotransferase family | 2.6E-54 | 18 | 228 |
PF07685 | GATase_3 | CobB/CobQ-like glutamine amidotransferase domain | 9.1E-09 | 45 | 146 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q8LAD0|PDX2_ARATH | Probable pyridoxal 5'-phosphate synthase subunit PDX2 OS=Arabidopsis thaliana GN=PDX2 PE=1 SV=1 | 14 | 226 | 1.0E-54 |
sp|Q54J48|PDX2_DICDI | Probable pyridoxal 5'-phosphate synthase subunit pdx2 OS=Dictyostelium discoideum GN=pdx2 PE=1 SV=1 | 13 | 231 | 8.0E-48 |
sp|Q81ZV5|PDXT_STRAW | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pdxT PE=3 SV=1 | 13 | 232 | 2.0E-47 |
sp|B1W3G0|PDXT_STRGG | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=pdxT PE=3 SV=1 | 13 | 225 | 6.0E-46 |
sp|Q03144|SNO1_YEAST | Pyridoxal 5'-phosphate synthase subunit SNO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO1 PE=1 SV=1 | 7 | 229 | 7.0E-46 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q8LAD0|PDX2_ARATH | Probable pyridoxal 5'-phosphate synthase subunit PDX2 OS=Arabidopsis thaliana GN=PDX2 PE=1 SV=1 | 14 | 226 | 1.0E-54 |
sp|Q54J48|PDX2_DICDI | Probable pyridoxal 5'-phosphate synthase subunit pdx2 OS=Dictyostelium discoideum GN=pdx2 PE=1 SV=1 | 13 | 231 | 8.0E-48 |
sp|Q81ZV5|PDXT_STRAW | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pdxT PE=3 SV=1 | 13 | 232 | 2.0E-47 |
sp|B1W3G0|PDXT_STRGG | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=pdxT PE=3 SV=1 | 13 | 225 | 6.0E-46 |
sp|Q03144|SNO1_YEAST | Pyridoxal 5'-phosphate synthase subunit SNO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO1 PE=1 SV=1 | 7 | 229 | 7.0E-46 |
sp|Q9L287|PDXT_STRCO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pdxT PE=3 SV=1 | 13 | 221 | 2.0E-45 |
sp|A9B890|PDXT_HERA2 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=pdxT PE=3 SV=1 | 14 | 225 | 8.0E-45 |
sp|Q4JVD5|PDXT_CORJK | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Corynebacterium jeikeium (strain K411) GN=pdxT PE=3 SV=1 | 14 | 232 | 2.0E-44 |
sp|A0JXB5|PDXT_ARTS2 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Arthrobacter sp. (strain FB24) GN=pdxT PE=3 SV=1 | 10 | 228 | 2.0E-44 |
sp|Q3Z8V9|PDXT_DEHM1 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=pdxT PE=3 SV=1 | 14 | 226 | 3.0E-44 |
sp|P53823|SNO2_YEAST | Probable pyridoxal 5'-phosphate synthase subunit SNO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO2 PE=3 SV=1 | 13 | 229 | 2.0E-43 |
sp|P43544|SNO3_YEAST | Probable pyridoxal 5'-phosphate synthase subunit SNO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO3 PE=1 SV=1 | 13 | 229 | 3.0E-43 |
sp|B1I158|PDXT_DESAP | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Desulforudis audaxviator (strain MP104C) GN=pdxT PE=3 SV=1 | 13 | 225 | 5.0E-43 |
sp|A1SJA2|PDXT_NOCSJ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Nocardioides sp. (strain BAA-499 / JS614) GN=pdxT PE=3 SV=1 | 15 | 232 | 8.0E-43 |
sp|A7NQB7|PDXT_ROSCS | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=pdxT PE=3 SV=1 | 14 | 225 | 1.0E-42 |
sp|Q5YTE0|PDXT_NOCFA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Nocardia farcinica (strain IFM 10152) GN=pdxT PE=3 SV=2 | 15 | 230 | 3.0E-42 |
sp|A5D6D2|PDXT_PELTS | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pdxT PE=3 SV=1 | 14 | 230 | 9.0E-42 |
sp|A5UY93|PDXT_ROSS1 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Roseiflexus sp. (strain RS-1) GN=pdxT PE=3 SV=1 | 14 | 225 | 1.0E-41 |
sp|Q1AWE7|PDXT_RUBXD | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pdxT PE=3 SV=1 | 16 | 228 | 2.0E-41 |
sp|A8A8T7|PDXT_IGNH4 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=pdxT PE=3 SV=2 | 14 | 227 | 4.0E-41 |
sp|Q2RMI9|PDXT_MOOTA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Moorella thermoacetica (strain ATCC 39073) GN=pdxT PE=3 SV=1 | 14 | 228 | 5.0E-41 |
sp|B6YVQ8|PDXT_THEON | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermococcus onnurineus (strain NA1) GN=pdxT PE=3 SV=1 | 13 | 229 | 6.0E-41 |
sp|B8H9E0|PDXT_ARTCA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=pdxT PE=3 SV=1 | 14 | 228 | 1.0E-40 |
sp|Q04F27|PDXT_OENOB | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=pdxT PE=3 SV=1 | 13 | 226 | 2.0E-40 |
sp|O59079|PDXT_PYRHO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pdxT PE=3 SV=1 | 14 | 229 | 2.0E-40 |
sp|Q929R8|PDXT_LISIN | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pdxT PE=3 SV=1 | 16 | 229 | 2.0E-40 |
sp|B0REB6|PDXT_CLAMS | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=pdxT PE=3 SV=1 | 16 | 225 | 2.0E-40 |
sp|A0AKK9|PDXT_LISW6 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=pdxT PE=3 SV=1 | 16 | 229 | 2.0E-40 |
sp|C1B4C5|PDXT_RHOOB | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Rhodococcus opacus (strain B4) GN=pdxT PE=3 SV=1 | 16 | 225 | 3.0E-40 |
sp|C5A4H0|PDXT_THEGJ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pdxT PE=3 SV=1 | 14 | 229 | 3.0E-40 |
sp|Q0S1D2|PDXT_RHOJR | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Rhodococcus jostii (strain RHA1) GN=pdxT PE=3 SV=1 | 16 | 225 | 4.0E-40 |
sp|A5CS10|PDXT_CLAM3 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=pdxT PE=3 SV=1 | 16 | 225 | 4.0E-40 |
sp|A0LUK9|PDXT_ACIC1 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=pdxT PE=3 SV=1 | 16 | 231 | 4.0E-40 |
sp|A1T876|PDXT_MYCVP | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pdxT PE=3 SV=1 | 16 | 225 | 5.0E-40 |
sp|Q5WKW1|PDXT_BACSK | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus clausii (strain KSM-K16) GN=pdxT PE=3 SV=1 | 14 | 228 | 6.0E-40 |
sp|Q6AFB8|PDXT_LEIXX | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pdxT PE=3 SV=1 | 16 | 228 | 7.0E-40 |
sp|A5FRL6|PDXT_DEHMB | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=pdxT PE=3 SV=1 | 14 | 226 | 7.0E-40 |
sp|Q47N39|PDXT_THEFY | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermobifida fusca (strain YX) GN=pdxT PE=3 SV=1 | 15 | 221 | 9.0E-40 |
sp|Q8TH23|PDXT_PYRFU | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pdxT PE=3 SV=1 | 14 | 229 | 1.0E-39 |
sp|B8DH16|PDXT_LISMH | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=pdxT PE=3 SV=1 | 16 | 229 | 1.0E-39 |
sp|A8KZF0|PDXT_FRASN | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Frankia sp. (strain EAN1pec) GN=pdxT PE=3 SV=1 | 16 | 231 | 2.0E-39 |
sp|B7GFL9|PDXT_ANOFW | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=pdxT PE=3 SV=1 | 14 | 228 | 2.0E-39 |
sp|A1R728|PDXT_ARTAT | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Arthrobacter aurescens (strain TC1) GN=pdxT PE=3 SV=2 | 14 | 228 | 2.0E-39 |
sp|Q6MEN7|PDXT_PARUW | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Protochlamydia amoebophila (strain UWE25) GN=pdxT PE=3 SV=1 | 14 | 228 | 2.0E-39 |
sp|B8G664|PDXT_CHLAD | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=pdxT PE=3 SV=1 | 14 | 225 | 2.0E-39 |
sp|Q83HM6|PDXT_TROW8 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Tropheryma whipplei (strain TW08/27) GN=pdxT PE=3 SV=1 | 14 | 225 | 3.0E-39 |
sp|A6WCI3|PDXT_KINRD | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=pdxT PE=3 SV=1 | 15 | 232 | 3.0E-39 |
sp|Q9UTE4|YFM8_SCHPO | Uncharacterized glutaminase C222.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.08c PE=3 SV=1 | 7 | 227 | 3.0E-39 |
sp|Q5L3Y1|PDXT_GEOKA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Geobacillus kaustophilus (strain HTA426) GN=pdxT PE=1 SV=1 | 14 | 228 | 4.0E-39 |
sp|Q83GK3|PDXT_TROWT | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Tropheryma whipplei (strain Twist) GN=pdxT PE=3 SV=1 | 14 | 225 | 5.0E-39 |
sp|Q3A8Q0|PDXT_CARHZ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pdxT PE=3 SV=1 | 14 | 230 | 7.0E-39 |
sp|A0QWH0|PDXT_MYCS2 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pdxT PE=1 SV=1 | 13 | 225 | 7.0E-39 |
sp|A3PYU8|PDXT_MYCSJ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium sp. (strain JLS) GN=pdxT PE=3 SV=1 | 16 | 225 | 8.0E-39 |
sp|A4IJ95|PDXT_GEOTN | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Geobacillus thermodenitrificans (strain NG80-2) GN=pdxT PE=3 SV=1 | 14 | 228 | 8.0E-39 |
sp|Q5JFR2|PDXT_THEKO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pdxT PE=3 SV=1 | 14 | 227 | 1.0E-38 |
sp|Q3ZX06|PDXT_DEHMC | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dehalococcoides mccartyi (strain CBDB1) GN=pdxT PE=3 SV=1 | 14 | 226 | 1.0E-38 |
sp|A3MZT9|PDXT_ACTP2 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pdxT PE=3 SV=1 | 11 | 228 | 2.0E-38 |
sp|Q6A947|PDXT_PROAC | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=pdxT PE=3 SV=1 | 16 | 228 | 2.0E-38 |
sp|A3DM32|PDXT_STAMF | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=pdxT PE=3 SV=1 | 14 | 231 | 2.0E-38 |
sp|Q8NS90|PDXT_CORGL | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pdxT PE=3 SV=1 | 14 | 225 | 3.0E-38 |
sp|C5D338|PDXT_GEOSW | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Geobacillus sp. (strain WCH70) GN=pdxT PE=3 SV=1 | 14 | 228 | 3.0E-38 |
sp|Q9V0J6|PDXT_PYRAB | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pdxT PE=3 SV=1 | 14 | 229 | 4.0E-38 |
sp|Q8TQH7|PDXT_METAC | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pdxT PE=3 SV=1 | 14 | 229 | 4.0E-38 |
sp|Q1B9S6|PDXT_MYCSS | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium sp. (strain MCS) GN=pdxT PE=3 SV=1 | 16 | 225 | 6.0E-38 |
sp|A1UF87|PDXT_MYCSK | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium sp. (strain KMS) GN=pdxT PE=3 SV=1 | 16 | 225 | 6.0E-38 |
sp|B0BUD1|PDXT_ACTPJ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pdxT PE=3 SV=1 | 11 | 228 | 6.0E-38 |
sp|B3GXB7|PDXT_ACTP7 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pdxT PE=3 SV=1 | 11 | 228 | 6.0E-38 |
sp|A4QCC4|PDXT_CORGB | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Corynebacterium glutamicum (strain R) GN=pdxT PE=3 SV=1 | 14 | 228 | 8.0E-38 |
sp|Q9HM60|PDXT_THEAC | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pdxT PE=3 SV=1 | 14 | 228 | 9.0E-38 |
sp|B7IEZ6|PDXT_THEAB | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermosipho africanus (strain TCF52B) GN=pdxT PE=3 SV=1 | 14 | 226 | 1.0E-37 |
sp|Q4PJX5|PDX2_PLABE | Pyridoxal 5'-phosphate synthase subunit Pdx2 OS=Plasmodium berghei GN=pdx2 PE=1 SV=1 | 14 | 231 | 1.0E-37 |
sp|Q8PUA4|PDXT_METMA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pdxT PE=3 SV=2 | 14 | 230 | 2.0E-37 |
sp|Q1IZC9|PDXT_DEIGD | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Deinococcus geothermalis (strain DSM 11300) GN=pdxT PE=3 SV=1 | 16 | 225 | 2.0E-37 |
sp|A7I472|PDXT_METB6 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanoregula boonei (strain 6A8) GN=pdxT PE=3 SV=2 | 14 | 228 | 3.0E-37 |
sp|C0ZH53|PDXT_BREBN | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pdxT PE=3 SV=1 | 14 | 232 | 3.0E-37 |
sp|Q7VL87|PDXT_HAEDU | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pdxT PE=3 SV=1 | 9 | 228 | 3.0E-37 |
sp|Q9KGN5|PDXT_BACHD | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pdxT PE=3 SV=1 | 14 | 228 | 3.0E-37 |
sp|Q8L1A7|PDXT_BACCI | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus circulans GN=pdxT PE=1 SV=1 | 14 | 232 | 3.0E-37 |
sp|B6YQU3|PDXT_AZOPC | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=pdxT PE=3 SV=1 | 14 | 229 | 3.0E-37 |
sp|C1KX54|PDXT_LISMC | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=pdxT PE=3 SV=1 | 16 | 229 | 5.0E-37 |
sp|C5CG73|PDXT_KOSOT | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Kosmotoga olearia (strain TBF 19.5.1) GN=pdxT PE=3 SV=1 | 14 | 229 | 6.0E-37 |
sp|Q97CP5|PDXT_THEVO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pdxT PE=3 SV=1 | 14 | 225 | 6.0E-37 |
sp|Q71XR2|PDXT_LISMF | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pdxT PE=3 SV=1 | 16 | 229 | 7.0E-37 |
sp|B1MCJ8|PDXT_MYCA9 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=pdxT PE=3 SV=1 | 16 | 225 | 1.0E-36 |
sp|Q8Y5G1|PDXT_LISMO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pdxT PE=3 SV=1 | 16 | 229 | 1.0E-36 |
sp|Q65PL1|PDXT_BACLD | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pdxT PE=3 SV=1 | 14 | 232 | 1.0E-36 |
sp|P83813|PDXT_GEOSE | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Geobacillus stearothermophilus GN=pdxT PE=1 SV=1 | 14 | 228 | 2.0E-36 |
sp|A5UK48|PDXT_METS3 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=pdxT PE=3 SV=1 | 14 | 230 | 2.0E-36 |
sp|O26292|PDXT_METTH | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pdxT PE=3 SV=1 | 14 | 230 | 2.0E-36 |
sp|Q465J4|PDXT_METBF | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pdxT PE=3 SV=1 | 14 | 231 | 3.0E-36 |
sp|A0QIC6|PDXT_MYCA1 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium avium (strain 104) GN=pdxT PE=3 SV=1 | 16 | 221 | 3.0E-36 |
sp|B9LIK4|PDXT_CHLSY | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pdxT PE=3 SV=1 | 14 | 225 | 3.0E-36 |
sp|A9WFU0|PDXT_CHLAA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pdxT PE=3 SV=1 | 14 | 225 | 3.0E-36 |
sp|O29741|PDXT_ARCFU | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pdxT PE=3 SV=1 | 14 | 226 | 3.0E-36 |
sp|Q5UZW7|PDXT_HALMA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pdxT PE=3 SV=1 | 13 | 221 | 5.0E-36 |
sp|A5MZY0|PDXT_CLOK5 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=pdxT PE=3 SV=1 | 14 | 225 | 5.0E-36 |
sp|B9E3V5|PDXT_CLOK1 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium kluyveri (strain NBRC 12016) GN=pdxT PE=3 SV=1 | 14 | 225 | 5.0E-36 |
sp|Q0RNV0|PDXT_FRAAA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Frankia alni (strain ACN14a) GN=pdxT PE=3 SV=1 | 16 | 230 | 7.0E-36 |
sp|Q3IU60|PDXT_NATPD | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pdxT PE=3 SV=1 | 14 | 221 | 8.0E-36 |
sp|A7Z0D4|PDXT_BACMF | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=pdxT PE=3 SV=1 | 14 | 226 | 1.0E-35 |
sp|A8F840|PDXT_PSELT | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=pdxT PE=3 SV=2 | 14 | 226 | 1.0E-35 |
sp|Q9CCT5|PDXT_MYCLE | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium leprae (strain TN) GN=pdxT PE=3 SV=2 | 16 | 225 | 1.0E-35 |
sp|A6LP41|PDXT_THEM4 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=pdxT PE=3 SV=1 | 14 | 225 | 2.0E-35 |
sp|Q72KF8|PDXT_THET2 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pdxT PE=3 SV=1 | 15 | 225 | 2.0E-35 |
sp|A4X5V4|PDXT_SALTO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=pdxT PE=3 SV=1 | 16 | 224 | 3.0E-35 |
sp|Q9YFK4|PDXT_AERPE | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pdxT PE=3 SV=2 | 14 | 230 | 3.0E-35 |
sp|A8LWZ5|PDXT_SALAI | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Salinispora arenicola (strain CNS-205) GN=pdxT PE=3 SV=1 | 16 | 224 | 3.0E-35 |
sp|A7HNV0|PDXT_FERNB | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=pdxT PE=3 SV=1 | 14 | 232 | 4.0E-35 |
sp|Q8CQV8|PDXT_STAES | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pdxT PE=3 SV=1 | 14 | 231 | 6.0E-35 |
sp|Q8IIK4|PDX2_PLAF7 | Pyridoxal 5'-phosphate synthase subunit Pdx2 OS=Plasmodium falciparum (isolate 3D7) GN=pdx2 PE=1 SV=2 | 12 | 232 | 7.0E-35 |
sp|A9WSE8|PDXT_RENSM | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=pdxT PE=3 SV=1 | 13 | 221 | 9.0E-35 |
sp|Q9HMD2|PDXT_HALSA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pdxT PE=3 SV=1 | 13 | 221 | 1.0E-34 |
sp|B0R879|PDXT_HALS3 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pdxT PE=3 SV=1 | 13 | 221 | 1.0E-34 |
sp|Q4J8L2|PDXT_SULAC | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pdxT PE=3 SV=1 | 14 | 230 | 1.0E-34 |
sp|Q5HRN4|PDXT_STAEQ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pdxT PE=3 SV=1 | 14 | 231 | 1.0E-34 |
sp|Q4L3H9|PDXT_STAHJ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pdxT PE=3 SV=1 | 14 | 230 | 1.0E-34 |
sp|A0RTP4|PDXT_CENSY | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Cenarchaeum symbiosum (strain A) GN=pdxT PE=3 SV=1 | 15 | 226 | 2.0E-34 |
sp|B8I364|PDXT_CLOCE | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=pdxT PE=3 SV=1 | 16 | 224 | 2.0E-34 |
sp|Q8TWH2|PDXT_METKA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pdxT PE=3 SV=1 | 27 | 228 | 2.0E-34 |
sp|A9A4S0|PDXT_NITMS | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Nitrosopumilus maritimus (strain SCM1) GN=pdxT PE=3 SV=1 | 16 | 226 | 2.0E-34 |
sp|B0K4N6|PDXT_THEPX | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermoanaerobacter sp. (strain X514) GN=pdxT PE=3 SV=1 | 14 | 226 | 3.0E-34 |
sp|B0KAS0|PDXT_THEP3 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=pdxT PE=3 SV=1 | 14 | 226 | 3.0E-34 |
sp|Q5SKD6|PDXT_THET8 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pdxT PE=1 SV=1 | 15 | 225 | 3.0E-34 |
sp|Q7A1R6|PDXT_STAAW | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain MW2) GN=pdxT PE=3 SV=1 | 14 | 231 | 4.0E-34 |
sp|A8YZL6|PDXT_STAAT | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pdxT PE=3 SV=1 | 14 | 231 | 4.0E-34 |
sp|Q6GBW8|PDXT_STAAS | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain MSSA476) GN=pdxT PE=3 SV=1 | 14 | 231 | 4.0E-34 |
sp|Q6GJE9|PDXT_STAAR | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain MRSA252) GN=pdxT PE=3 SV=1 | 14 | 231 | 4.0E-34 |
sp|Q7A7A1|PDXT_STAAN | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain N315) GN=pdxT PE=1 SV=1 | 14 | 231 | 4.0E-34 |
sp|Q99W83|PDXT_STAAM | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdxT PE=3 SV=1 | 14 | 231 | 4.0E-34 |
sp|A6QEH2|PDXT_STAAE | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain Newman) GN=pdxT PE=3 SV=1 | 14 | 231 | 4.0E-34 |
sp|Q5HIF4|PDXT_STAAC | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain COL) GN=pdxT PE=3 SV=1 | 14 | 231 | 4.0E-34 |
sp|Q2YSE1|PDXT_STAAB | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pdxT PE=3 SV=1 | 14 | 231 | 4.0E-34 |
sp|A5IQ73|PDXT_STAA9 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain JH9) GN=pdxT PE=3 SV=1 | 14 | 231 | 4.0E-34 |
sp|Q2G0Q0|PDXT_STAA8 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain NCTC 8325) GN=pdxT PE=3 SV=1 | 14 | 231 | 4.0E-34 |
sp|Q2FJC0|PDXT_STAA3 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain USA300) GN=pdxT PE=3 SV=1 | 14 | 231 | 4.0E-34 |
sp|A6TYZ6|PDXT_STAA2 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain JH1) GN=pdxT PE=3 SV=1 | 14 | 231 | 4.0E-34 |
sp|A7WYT2|PDXT_STAA1 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=pdxT PE=3 SV=1 | 14 | 231 | 4.0E-34 |
sp|Q2JD98|PDXT_FRASC | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Frankia sp. (strain CcI3) GN=pdxT PE=3 SV=1 | 16 | 228 | 5.0E-34 |
sp|Q9RUL8|PDXT_DEIRA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pdxT PE=3 SV=1 | 14 | 225 | 5.0E-34 |
sp|Q1IQH8|PDXT_KORVE | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Koribacter versatilis (strain Ellin345) GN=pdxT PE=3 SV=1 | 14 | 228 | 6.0E-34 |
sp|Q8RBJ4|PDXT_CALS4 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pdxT PE=3 SV=1 | 14 | 226 | 7.0E-34 |
sp|P9WII7|PDXT_MYCTU | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pdxT PE=1 SV=1 | 16 | 225 | 8.0E-34 |
sp|P9WII6|PDXT_MYCTO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pdxT PE=3 SV=1 | 16 | 225 | 8.0E-34 |
sp|A5U5V5|PDXT_MYCTA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pdxT PE=3 SV=1 | 16 | 225 | 8.0E-34 |
sp|C1AF75|PDXT_MYCBT | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=pdxT PE=3 SV=1 | 16 | 225 | 8.0E-34 |
sp|A1KLV4|PDXT_MYCBP | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pdxT PE=3 SV=1 | 16 | 225 | 8.0E-34 |
sp|Q7TY92|PDXT_MYCBO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pdxT PE=3 SV=1 | 16 | 225 | 8.0E-34 |
sp|Q9UWX4|PDXT_SULSO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pdxT PE=3 SV=1 | 14 | 225 | 2.0E-33 |
sp|A4FBA2|PDXT_SACEN | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=pdxT PE=3 SV=1 | 16 | 228 | 2.0E-33 |
sp|A7GJS9|PDXT_BACCN | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pdxT PE=3 SV=1 | 14 | 228 | 2.0E-33 |
sp|B9KBI1|PDXT_THENN | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=pdxT PE=3 SV=1 | 14 | 225 | 3.0E-33 |
sp|Q12YR6|PDXT_METBU | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pdxT PE=3 SV=1 | 14 | 230 | 4.0E-33 |
sp|P45294|PDXT_HAEIN | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pdxT PE=3 SV=2 | 14 | 225 | 4.0E-33 |
sp|A5UBN1|PDXT_HAEIE | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus influenzae (strain PittEE) GN=pdxT PE=3 SV=1 | 14 | 225 | 4.0E-33 |
sp|Q4QJU4|PDXT_HAEI8 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus influenzae (strain 86-028NP) GN=pdxT PE=3 SV=1 | 14 | 225 | 4.0E-33 |
sp|B9IYH9|PDXT_BACCQ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain Q1) GN=pdxT PE=3 SV=1 | 14 | 228 | 4.0E-33 |
sp|B7HPS7|PDXT_BACC7 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain AH187) GN=pdxT PE=3 SV=1 | 14 | 228 | 4.0E-33 |
sp|Q73FJ4|PDXT_BACC1 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pdxT PE=3 SV=1 | 14 | 228 | 4.0E-33 |
sp|Q97LG6|PDXT_CLOAB | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pdxT PE=3 SV=1 | 14 | 226 | 5.0E-33 |
sp|Q6NK10|PDXT_CORDI | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pdxT PE=3 SV=1 | 14 | 228 | 5.0E-33 |
sp|P37528|PDXT_BACSU | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus subtilis (strain 168) GN=pdxT PE=1 SV=1 | 14 | 228 | 6.0E-33 |
sp|A8FAD6|PDXT_BACP2 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus pumilus (strain SAFR-032) GN=pdxT PE=3 SV=1 | 14 | 228 | 7.0E-33 |
sp|A5IJU9|PDXT_THEP1 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=pdxT PE=3 SV=1 | 14 | 225 | 1.0E-32 |
sp|Q63HF7|PDXT_BACCZ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain ZK / E33L) GN=pdxT PE=3 SV=1 | 14 | 228 | 1.0E-32 |
sp|Q18KL6|PDXT_HALWD | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pdxT PE=3 SV=1 | 14 | 221 | 1.0E-32 |
sp|B9DKX8|PDXT_STACT | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus carnosus (strain TM300) GN=pdxT PE=3 SV=1 | 14 | 231 | 1.0E-32 |
sp|A5UF87|PDXT_HAEIG | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Haemophilus influenzae (strain PittGG) GN=pdxT PE=3 SV=1 | 14 | 225 | 1.0E-32 |
sp|A0PSY6|PDXT_MYCUA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium ulcerans (strain Agy99) GN=pdxT PE=3 SV=1 | 16 | 225 | 2.0E-32 |
sp|B2HN48|PDXT_MYCMM | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pdxT PE=3 SV=1 | 16 | 225 | 2.0E-32 |
sp|A2SPK0|PDXT_METLZ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pdxT PE=3 SV=1 | 14 | 228 | 2.0E-32 |
sp|Q0W8A8|PDXT_METAR | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pdxT PE=3 SV=1 | 14 | 229 | 2.0E-32 |
sp|Q9WYU3|PDXT_THEMA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pdxT PE=1 SV=1 | 14 | 225 | 2.0E-32 |
sp|Q8EN04|PDXT_OCEIH | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pdxT PE=3 SV=2 | 13 | 228 | 2.0E-32 |
sp|Q81JC5|PDXT_BACCR | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pdxT PE=3 SV=1 | 14 | 228 | 2.0E-32 |
sp|B7HII4|PDXT_BACC4 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain B4264) GN=pdxT PE=3 SV=1 | 14 | 228 | 2.0E-32 |
sp|A9VMA0|PDXT_BACWK | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus weihenstephanensis (strain KBAB4) GN=pdxT PE=3 SV=1 | 14 | 228 | 2.0E-32 |
sp|A4J0G0|PDXT_DESRM | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Desulfotomaculum reducens (strain MI-1) GN=pdxT PE=3 SV=1 | 14 | 228 | 3.0E-32 |
sp|B7IS30|PDXT_BACC2 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain G9842) GN=pdxT PE=3 SV=1 | 14 | 228 | 4.0E-32 |
sp|Q8G575|PDXT_BIFLO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bifidobacterium longum (strain NCC 2705) GN=pdxT PE=3 SV=2 | 17 | 225 | 6.0E-32 |
sp|Q9CLJ5|PDXT_PASMU | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pasteurella multocida (strain Pm70) GN=pdxT PE=3 SV=1 | 11 | 226 | 6.0E-32 |
sp|B1L921|PDXT_THESQ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Thermotoga sp. (strain RQ2) GN=pdxT PE=3 SV=1 | 14 | 225 | 7.0E-32 |
sp|Q49V29|PDXT_STAS1 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pdxT PE=3 SV=1 | 14 | 230 | 9.0E-32 |
sp|B8GE19|PDXT_METPE | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pdxT PE=3 SV=1 | 14 | 225 | 1.0E-31 |
sp|B5YF84|PDXT_DICT6 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=pdxT PE=3 SV=1 | 14 | 226 | 2.0E-31 |
sp|A4YI12|PDXT_METS5 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=pdxT PE=3 SV=1 | 14 | 230 | 2.0E-31 |
sp|C3MW85|PDXT_SULIM | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pdxT PE=3 SV=1 | 14 | 225 | 3.0E-31 |
sp|C4KHU2|PDXT_SULIK | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pdxT PE=3 SV=1 | 14 | 225 | 3.0E-31 |
sp|C3N6C7|PDXT_SULIA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain M.16.27) GN=pdxT PE=3 SV=1 | 14 | 225 | 3.0E-31 |
sp|C3MQK7|PDXT_SULIL | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pdxT PE=3 SV=1 | 14 | 225 | 5.0E-31 |
sp|A6M3G5|PDXT_CLOB8 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=pdxT PE=3 SV=1 | 14 | 226 | 6.0E-31 |
sp|Q971B2|PDXT_SULTO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pdxT PE=3 SV=1 | 14 | 226 | 1.0E-30 |
sp|Q6L1R3|PDXT_PICTO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=pdxT PE=3 SV=1 | 14 | 229 | 2.0E-30 |
sp|Q59055|PDXT_METJA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pdxT PE=1 SV=1 | 14 | 231 | 2.0E-30 |
sp|C1CQQ1|PDXT_STRZT | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=pdxT PE=3 SV=1 | 14 | 226 | 2.0E-30 |
sp|C1CLG6|PDXT_STRZP | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain P1031) GN=pdxT PE=3 SV=1 | 14 | 226 | 2.0E-30 |
sp|C1CF49|PDXT_STRZJ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain JJA) GN=pdxT PE=3 SV=1 | 14 | 226 | 2.0E-30 |
sp|Q97PX3|PDXT_STRPN | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pdxT PE=3 SV=1 | 14 | 226 | 2.0E-30 |
sp|B8ZL13|PDXT_STRPJ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=pdxT PE=3 SV=1 | 14 | 226 | 2.0E-30 |
sp|B1ICP8|PDXT_STRPI | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=pdxT PE=3 SV=1 | 14 | 226 | 2.0E-30 |
sp|C1C862|PDXT_STRP7 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain 70585) GN=pdxT PE=3 SV=1 | 14 | 226 | 2.0E-30 |
sp|C3NET5|PDXT_SULIY | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pdxT PE=3 SV=1 | 14 | 225 | 2.0E-30 |
sp|A2BLL6|PDXT_HYPBU | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=pdxT PE=3 SV=1 | 14 | 221 | 2.0E-30 |
sp|B2IQT4|PDXT_STRPS | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain CGSP14) GN=pdxT PE=3 SV=1 | 14 | 232 | 3.0E-30 |
sp|B0TZ16|PDXT_FRAP2 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=pdxT PE=3 SV=1 | 13 | 226 | 3.0E-30 |
sp|Q24PK8|PDXT_DESHY | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Desulfitobacterium hafniense (strain Y51) GN=pdxT PE=3 SV=1 | 14 | 228 | 4.0E-30 |
sp|A0B7N4|PDXT_METTP | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pdxT PE=3 SV=1 | 16 | 225 | 5.0E-30 |
sp|B1YGC2|PDXT_EXIS2 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=pdxT PE=3 SV=1 | 14 | 231 | 5.0E-30 |
sp|A3MSM9|PDXT_PYRCJ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pdxT PE=3 SV=1 | 14 | 230 | 7.0E-30 |
sp|A3CRE5|PDXT_METMJ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pdxT PE=3 SV=1 | 14 | 225 | 7.0E-30 |
sp|C3NGV9|PDXT_SULIN | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pdxT PE=3 SV=1 | 14 | 225 | 7.0E-30 |
sp|A1RU67|PDXT_PYRIL | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=pdxT PE=3 SV=1 | 14 | 226 | 7.0E-30 |
sp|Q6HQ04|PDXT_BACHK | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pdxT PE=3 SV=1 | 14 | 228 | 8.0E-30 |
sp|C1ES18|PDXT_BACC3 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain 03BB102) GN=pdxT PE=3 SV=1 | 14 | 228 | 8.0E-30 |
sp|B7JJC7|PDXT_BACC0 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus cereus (strain AH820) GN=pdxT PE=3 SV=1 | 14 | 228 | 8.0E-30 |
sp|A0R890|PDXT_BACAH | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus thuringiensis (strain Al Hakam) GN=pdxT PE=3 SV=2 | 14 | 228 | 8.0E-30 |
sp|B8E120|PDXT_DICTD | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=pdxT PE=3 SV=1 | 14 | 226 | 9.0E-30 |
sp|A4XIB6|PDXT_CALS8 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=pdxT PE=3 SV=1 | 16 | 230 | 9.0E-30 |
sp|B8FZR4|PDXT_DESHD | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=pdxT PE=3 SV=1 | 14 | 228 | 1.0E-29 |
sp|Q8DP72|PDXT_STRR6 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pdxT PE=3 SV=1 | 14 | 226 | 1.0E-29 |
sp|Q04JN6|PDXT_STRP2 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=pdxT PE=3 SV=1 | 14 | 226 | 1.0E-29 |
sp|B5E5W0|PDXT_STRP4 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=pdxT PE=3 SV=1 | 14 | 226 | 1.0E-29 |
sp|A4IZB4|PDXT_FRATW | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=pdxT PE=3 SV=1 | 13 | 225 | 2.0E-29 |
sp|Q5NHE5|PDXT_FRATT | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=pdxT PE=3 SV=2 | 13 | 225 | 2.0E-29 |
sp|B2SDL4|PDXT_FRATM | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=pdxT PE=3 SV=1 | 13 | 225 | 2.0E-29 |
sp|Q14IU7|PDXT_FRAT1 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=pdxT PE=3 SV=2 | 13 | 225 | 2.0E-29 |
sp|Q81W26|PDXT_BACAN | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus anthracis GN=pdxT PE=3 SV=1 | 14 | 228 | 2.0E-29 |
sp|C3LIY8|PDXT_BACAC | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pdxT PE=3 SV=1 | 14 | 228 | 2.0E-29 |
sp|C3P8Q4|PDXT_BACAA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bacillus anthracis (strain A0248) GN=pdxT PE=3 SV=1 | 14 | 228 | 2.0E-29 |
sp|Q0BKT3|PDXT_FRATO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=pdxT PE=3 SV=2 | 13 | 225 | 3.0E-29 |
sp|Q2A261|PDXT_FRATH | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. holarctica (strain LVS) GN=pdxT PE=3 SV=1 | 13 | 225 | 3.0E-29 |
sp|A7NDQ2|PDXT_FRATF | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=pdxT PE=3 SV=1 | 13 | 225 | 3.0E-29 |
sp|Q2FTH1|PDXT_METHJ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pdxT PE=3 SV=1 | 16 | 229 | 4.0E-29 |
sp|A0Q5I2|PDXT_FRATN | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Francisella tularensis subsp. novicida (strain U112) GN=pdxT PE=3 SV=1 | 13 | 225 | 5.0E-29 |
sp|B9LSC8|PDXT_HALLT | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=pdxT PE=3 SV=1 | 46 | 221 | 8.0E-29 |
sp|A1A3A4|PDXT_BIFAA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=pdxT PE=3 SV=2 | 17 | 225 | 1.0E-28 |
sp|B1KYX4|PDXT_CLOBM | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=pdxT PE=3 SV=1 | 14 | 232 | 2.0E-28 |
sp|B1YB90|PDXT_PYRNV | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=pdxT PE=3 SV=1 | 14 | 225 | 4.0E-28 |
sp|Q2NGI4|PDXT_METST | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pdxT PE=3 SV=1 | 14 | 228 | 6.0E-28 |
sp|B9MKY8|PDXT_CALBD | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=pdxT PE=3 SV=1 | 15 | 230 | 1.0E-27 |
sp|A9A909|PDXT_METM6 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pdxT PE=3 SV=1 | 16 | 231 | 2.0E-27 |
sp|A4WHH5|PDXT_PYRAR | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=pdxT PE=3 SV=1 | 14 | 215 | 2.0E-27 |
sp|B1L4Z3|PDXT_KORCO | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Korarchaeum cryptofilum (strain OPF8) GN=pdxT PE=3 SV=1 | 14 | 229 | 1.0E-26 |
sp|P0C036|PDXT_METMP | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus maripaludis (strain S2 / LL) GN=pdxT PE=3 SV=1 | 16 | 232 | 1.0E-26 |
sp|Q02CB5|PDXT_SOLUE | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Solibacter usitatus (strain Ellin6076) GN=pdxT PE=3 SV=1 | 16 | 228 | 2.0E-26 |
sp|A6UWZ3|PDXT_META3 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pdxT PE=3 SV=1 | 14 | 231 | 3.0E-26 |
sp|Q73WF2|PDXT_MYCPA | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pdxT PE=3 SV=1 | 16 | 200 | 6.0E-26 |
sp|A6UQT7|PDXT_METVS | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pdxT PE=3 SV=1 | 16 | 232 | 9.0E-26 |
sp|A4G0R6|PDXT_METM5 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pdxT PE=3 SV=1 | 16 | 232 | 2.0E-25 |
sp|A6VHR9|PDXT_METM7 | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pdxT PE=3 SV=1 | 16 | 232 | 3.0E-25 |
sp|Q8ZUE9|PDXT_PYRAE | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pdxT PE=3 SV=1 | 14 | 223 | 1.0E-23 |
sp|A8MAY1|PDXT_CALMQ | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=pdxT PE=3 SV=1 | 14 | 231 | 9.0E-22 |
sp|Q2LXR3|PDXT_SYNAS | Pyridoxal 5'-phosphate synthase subunit PdxT OS=Syntrophus aciditrophicus (strain SB) GN=pdxT PE=3 SV=1 | 15 | 215 | 1.0E-18 |
GO Term | Description | Terminal node |
---|---|---|
GO:0003824 | catalytic activity | Yes |
GO:0004359 | glutaminase activity | Yes |
GO:0042823 | pyridoxal phosphate biosynthetic process | Yes |
GO:0042819 | vitamin B6 biosynthetic process | Yes |
GO:0046483 | heterocycle metabolic process | No |
GO:0003674 | molecular_function | No |
GO:0044237 | cellular metabolic process | No |
GO:0008152 | metabolic process | No |
GO:0072525 | pyridine-containing compound biosynthetic process | No |
GO:0044283 | small molecule biosynthetic process | No |
GO:0042822 | pyridoxal phosphate metabolic process | No |
GO:0006766 | vitamin metabolic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0044281 | small molecule metabolic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0006767 | water-soluble vitamin metabolic process | No |
GO:0006796 | phosphate-containing compound metabolic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0018130 | heterocycle biosynthetic process | No |
GO:0046184 | aldehyde biosynthetic process | No |
GO:0006725 | cellular aromatic compound metabolic process | No |
GO:0008150 | biological_process | No |
GO:1901360 | organic cyclic compound metabolic process | No |
GO:0042364 | water-soluble vitamin biosynthetic process | No |
GO:0016810 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds | No |
GO:0009058 | biosynthetic process | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:0090407 | organophosphate biosynthetic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0006081 | cellular aldehyde metabolic process | No |
GO:1901362 | organic cyclic compound biosynthetic process | No |
GO:1901615 | organic hydroxy compound metabolic process | No |
GO:0019637 | organophosphate metabolic process | No |
GO:0072524 | pyridine-containing compound metabolic process | No |
GO:0042816 | vitamin B6 metabolic process | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:1901617 | organic hydroxy compound biosynthetic process | No |
GO:0016787 | hydrolase activity | No |
GO:0009987 | cellular process | No |
GO:0009110 | vitamin biosynthetic process | No |
GO:0016811 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides | No |
GO:0019438 | aromatic compound biosynthetic process | No |
GO:0006793 | phosphorus metabolic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 27 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophio5|3342 MTAQSRLDAAHATLTVGVLALQGGFAEHIRLLRCAAEIVCPSSHIRVIEVRSPPELARCDALVIPGGESTAISFV AAQSGLLEPLRQFVKVEKKPVWGTCAGLILLSEHVNATKKGGQEVIGGIDVRVHRNHFGRQIESFETDVDLPFLA GDDSASTTFPGVFIRAPVVEDVLPGAAVSVLATLPSRDKVRRGAGDIIAVRQGNAFGTSFHPELTADPRIHVWWL REILRQR |
Coding | >Ophio5|3342 ATGACAGCCCAGTCCCGGCTCGACGCGGCCCACGCCACCCTCACAGTCGGCGTCCTCGCCCTTCAGGGAGGCTTC GCCGAGCATATTCGTCTCCTGCGCTGTGCCGCCGAAATCGTCTGTCCTTCGTCTCATATCCGGGTCATCGAGGTG CGCTCTCCGCCGGAGCTGGCCCGGTGTGACGCCCTCGTGATACCCGGTGGCGAGAGCACAGCCATCTCCTTTGTC GCCGCTCAGTCGGGCCTTCTGGAGCCGCTCCGACAGTTTGTCAAGGTCGAGAAGAAGCCCGTCTGGGGCACCTGC GCCGGTCTCATCCTCCTCTCGGAACACGTCAACGCAACGAAAAAGGGCGGCCAGGAGGTCATCGGCGGCATCGAC GTCCGCGTCCACCGCAACCACTTCGGCCGCCAGATCGAGAGCTTCGAGACCGACGTCGACCTGCCATTTCTAGCC GGCGACGACTCAGCCTCCACGACATTCCCTGGTGTCTTCATCCGCGCTCCTGTGGTGGAGGATGTCTTGCCCGGC GCTGCCGTCTCCGTCCTTGCCACTCTGCCTTCTCGCGACAAGGTCAGGCGCGGCGCTGGCGATATCATTGCTGTG CGCCAGGGCAATGCCTTTGGCACTAGCTTCCACCCGGAGCTGACGGCCGATCCGCGCATTCATGTCTGGTGGCTG CGCGAGATTCTGCGGCAGAGA |
Transcript | >Ophio5|3342 ATGACAGCCCAGTCCCGGCTCGACGCGGCCCACGCCACCCTCACAGTCGGCGTCCTCGCCCTTCAGGGAGGCTTC GCCGAGCATATTCGTCTCCTGCGCTGTGCCGCCGAAATCGTCTGTCCTTCGTCTCATATCCGGGTCATCGAGGTG CGCTCTCCGCCGGAGCTGGCCCGGTGTGACGCCCTCGTGATACCCGGTGGCGAGAGCACAGCCATCTCCTTTGTC GCCGCTCAGTCGGGCCTTCTGGAGCCGCTCCGACAGTTTGTCAAGGTCGAGAAGAAGCCCGTCTGGGGCACCTGC GCCGGTCTCATCCTCCTCTCGGAACACGTCAACGCAACGAAAAAGGGCGGCCAGGAGGTCATCGGCGGCATCGAC GTCCGCGTCCACCGCAACCACTTCGGCCGCCAGATCGAGAGCTTCGAGACCGACGTCGACCTGCCATTTCTAGCC GGCGACGACTCAGCCTCCACGACATTCCCTGGTGTCTTCATCCGCGCTCCTGTGGTGGAGGATGTCTTGCCCGGC GCTGCCGTCTCCGTCCTTGCCACTCTGCCTTCTCGCGACAAGGTCAGGCGCGGCGCTGGCGATATCATTGCTGTG CGCCAGGGCAATGCCTTTGGCACTAGCTTCCACCCGGAGCTGACGGCCGATCCGCGCATTCATGTCTGGTGGCTG CGCGAGATTCTGCGGCAGAGATAG |
Gene | >Ophio5|3342 ATGACAGCCCAGTCCCGGCTCGACGCGGCCCACGCCACCCTCACAGTCGGCGTCCTCGCCCTTCAGGGAGGCTTC GCCGAGCATATTCGTCTCCTGCGCTGTGCCGCCGAAATCGTCTGTCCTTCGTCTCATATCCGGGTCATCGAGGTG CGCTCTCCGCCGGAGCTGGCCCGGTGTGACGCCCTCGTGATACCCGGTGGCGAGAGCACAGCCATCTCCTTTGTC GCCGCTCAGTCGGGCCTTCTGGAGCCGCTCCGACAGTTTGTCAAGTCAGCTTCCCCTCTTCGTTGAGTGTGGTGG GACTGGGTCGCGGTGCTGACGGTCAAAAACCGCTATAGGGTCGAGAAGAAGCCCGTCTGGGGCACCTGCGCCGGT CTCATCCTCCTCTCGGAACACGTCAACGCAACGAAAAAGGGCGGCCAGGAGGTCATCGGCGGCATCGACGTCCGC GTCCACCGCAACCACTTCGGCCGCCAGATCGAGAGCTTCGAGACCGACGTCGACCTGCCATTTCTAGCCGGCGAC GACTCAGCCTCCACGACATTCCCTGGTGTCTTCATCCGCGCTCCTGTGGTGGAGGATGTCTTGCCCGGCGCTGCC GTCTCCGTCCTTGCCACTCTGCCTTCTCGCGACAAGGTCAGGCGCGGCGCTGGCGATATCATTGCTGTGCGCCAG GGCAATGCCTTTGGCACTAGCTTCCACCCGGAGCTGACGGCCGATCCGCGCATTCATGTCTGGTGGCTGCGCGAG ATTCTGCGGCAGAGATAG |