Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3339
Gene name
Locationscaffold_265:6205..7123
Strand-
Gene length (bp)918
Transcript length (bp)918
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01680 SOR_SNZ SOR/SNZ family 2.1E-102 14 223
PF05690 ThiG Thiazole biosynthesis protein ThiG 3.5E-07 211 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59905|PDX1_CERNC Pyridoxal 5'-phosphate synthase subunit PDX1 OS=Cercospora nicotianae GN=PDX1 PE=1 SV=1 5 304 5.0E-161
sp|Q9UW83|PDX1_EMENI Pyridoxal 5'-phosphate synthase subunit pyroA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pyroA PE=3 SV=1 6 304 7.0E-155
sp|B9LIK3|PDXS_CHLSY Pyridoxal 5'-phosphate synthase subunit PdxS OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pdxS PE=3 SV=1 11 304 6.0E-144
sp|A9WFT9|PDXS_CHLAA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pdxS PE=3 SV=1 11 304 6.0E-144
sp|Q9C1K6|PDX1_NEUCR Probable pyridoxal 5'-phosphate synthase subunit pdx-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pdx-1 PE=3 SV=1 2 304 1.0E-143
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59905|PDX1_CERNC Pyridoxal 5'-phosphate synthase subunit PDX1 OS=Cercospora nicotianae GN=PDX1 PE=1 SV=1 5 304 5.0E-161
sp|Q9UW83|PDX1_EMENI Pyridoxal 5'-phosphate synthase subunit pyroA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pyroA PE=3 SV=1 6 304 7.0E-155
sp|B9LIK3|PDXS_CHLSY Pyridoxal 5'-phosphate synthase subunit PdxS OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pdxS PE=3 SV=1 11 304 6.0E-144
sp|A9WFT9|PDXS_CHLAA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pdxS PE=3 SV=1 11 304 6.0E-144
sp|Q9C1K6|PDX1_NEUCR Probable pyridoxal 5'-phosphate synthase subunit pdx-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pdx-1 PE=3 SV=1 2 304 1.0E-143
sp|A9B891|PDXS_HERA2 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=pdxS PE=3 SV=1 12 304 2.0E-143
sp|Q9AT63|PDX1_GINBI Probable pyridoxal 5'-phosphate synthase subunit PDX1 OS=Ginkgo biloba GN=PDX1 PE=2 SV=1 12 303 3.0E-143
sp|B8G663|PDXS_CHLAD Pyridoxal 5'-phosphate synthase subunit PdxS OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=pdxS PE=3 SV=1 11 304 5.0E-143
sp|O14027|PDX1_SCHPO Probable pyridoxal 5'-phosphate synthase subunit PDX1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snz1 PE=1 SV=1 11 304 3.0E-142
sp|Q54J47|PDX1_DICDI Probable pyridoxal 5'-phosphate synthase subunit pdx1 OS=Dictyostelium discoideum GN=pdx1 PE=1 SV=1 4 299 5.0E-141
sp|Q5SKD9|PDXS_THET8 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pdxS PE=1 SV=2 10 304 1.0E-138
sp|Q72KG1|PDXS_THET2 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pdxS PE=3 SV=1 10 304 2.0E-138
sp|Q8L940|PDX13_ARATH Pyridoxal 5'-phosphate synthase subunit PDX1.3 OS=Arabidopsis thaliana GN=PDX13 PE=1 SV=2 3 303 1.0E-137
sp|A5UY94|PDXS_ROSS1 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Roseiflexus sp. (strain RS-1) GN=pdxS PE=3 SV=1 11 304 2.0E-137
sp|A7NQB8|PDXS_ROSCS Pyridoxal 5'-phosphate synthase subunit PdxS OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=pdxS PE=3 SV=1 11 304 7.0E-137
sp|O80448|PDX11_ARATH Pyridoxal 5'-phosphate synthase subunit PDX1.1 OS=Arabidopsis thaliana GN=PDX11 PE=1 SV=1 10 303 9.0E-137
sp|Q9FT25|PDX1_PHAVU Pyridoxal 5'-phosphate synthase subunit PDX1 OS=Phaseolus vulgaris GN=PDX1 PE=2 SV=1 3 303 1.0E-136
sp|Q8WPW2|PDX1_SUBDO Pyridoxal 5'-phosphate synthase subunit SNZERR OS=Suberites domuncula GN=SNZERR PE=2 SV=2 13 303 1.0E-136
sp|Q69LA6|PDX11_ORYSJ Probable pyridoxal 5'-phosphate synthase subunit PDX1.1 OS=Oryza sativa subsp. japonica GN=PDX11 PE=2 SV=1 7 303 2.0E-136
sp|Q39963|PDX1_HEVBR Probable pyridoxal 5'-phosphate synthase subunit PDX1 OS=Hevea brasiliensis GN=PDX1 PE=2 SV=1 3 303 4.0E-136
sp|Q8W3D0|PDX12_ORYSJ Probable pyridoxal 5'-phosphate synthase subunit PDX1.2 OS=Oryza sativa subsp. japonica GN=PDX12 PE=2 SV=1 13 303 1.0E-134
sp|Q9L286|PDXS_STRCO Pyridoxal 5'-phosphate synthase subunit PdxS OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pdxS PE=3 SV=1 16 304 2.0E-134
sp|Q827U0|PDXS_STRAW Pyridoxal 5'-phosphate synthase subunit PdxS OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pdxS PE=3 SV=1 16 304 3.0E-134
sp|B0TAQ4|PDXS_HELMI Pyridoxal 5'-phosphate synthase subunit PdxS OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=pdxS PE=3 SV=1 13 304 2.0E-133
sp|B2A2Z7|PDXS_NATTJ Pyridoxal 5'-phosphate synthase subunit PdxS OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=pdxS PE=3 SV=1 8 304 5.0E-133
sp|A4IZB5|PDXS_FRATW Pyridoxal 5'-phosphate synthase subunit PdxS OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=pdxS PE=3 SV=1 12 304 1.0E-132
sp|Q5NHE6|PDXS_FRATT Pyridoxal 5'-phosphate synthase subunit PdxS OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=pdxS PE=3 SV=1 12 304 1.0E-132
sp|Q0BKT2|PDXS_FRATO Pyridoxal 5'-phosphate synthase subunit PdxS OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=pdxS PE=3 SV=1 12 304 1.0E-132
sp|A0Q5I1|PDXS_FRATN Pyridoxal 5'-phosphate synthase subunit PdxS OS=Francisella tularensis subsp. novicida (strain U112) GN=pdxS PE=3 SV=1 12 304 1.0E-132
sp|Q2A260|PDXS_FRATH Pyridoxal 5'-phosphate synthase subunit PdxS OS=Francisella tularensis subsp. holarctica (strain LVS) GN=pdxS PE=3 SV=1 12 304 1.0E-132
sp|A7NDQ3|PDXS_FRATF Pyridoxal 5'-phosphate synthase subunit PdxS OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=pdxS PE=3 SV=1 12 304 1.0E-132
sp|Q14IU8|PDXS_FRAT1 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=pdxS PE=3 SV=1 12 304 1.0E-132
sp|B2SDL5|PDXS_FRATM Pyridoxal 5'-phosphate synthase subunit PdxS OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=pdxS PE=3 SV=1 12 304 1.0E-132
sp|B8I363|PDXS_CLOCE Pyridoxal 5'-phosphate synthase subunit PdxS OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=pdxS PE=3 SV=1 16 304 2.0E-132
sp|Q3ZZB8|PDXS_DEHMC Pyridoxal 5'-phosphate synthase subunit PdxS OS=Dehalococcoides mccartyi (strain CBDB1) GN=pdxS PE=3 SV=1 13 304 3.0E-132
sp|A5FS82|PDXS_DEHMB Pyridoxal 5'-phosphate synthase subunit PdxS OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=pdxS PE=3 SV=1 13 304 3.0E-132
sp|Q2LXR2|PDXS_SYNAS Pyridoxal 5'-phosphate synthase subunit PdxS OS=Syntrophus aciditrophicus (strain SB) GN=pdxS PE=3 SV=1 20 304 4.0E-132
sp|B0KAS1|PDXS_THEP3 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=pdxS PE=3 SV=1 16 304 3.0E-131
sp|Q8RBJ3|PDXS_CALS4 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pdxS PE=3 SV=1 16 304 3.0E-131
sp|Q6M115|PDXS_METMP Pyridoxal 5'-phosphate synthase subunit PdxS OS=Methanococcus maripaludis (strain S2 / LL) GN=pdxS PE=3 SV=1 16 304 7.0E-131
sp|B0K4N7|PDXS_THEPX Pyridoxal 5'-phosphate synthase subunit PdxS OS=Thermoanaerobacter sp. (strain X514) GN=pdxS PE=3 SV=1 16 304 2.0E-130
sp|B8J2D5|PDXS_DESDA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=pdxS PE=3 SV=1 10 304 2.0E-130
sp|A6VI92|PDXS_METM7 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pdxS PE=3 SV=1 16 304 2.0E-130
sp|A9A8I8|PDXS_METM6 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pdxS PE=3 SV=1 16 304 4.0E-130
sp|B0TZ17|PDXS_FRAP2 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=pdxS PE=3 SV=1 12 304 6.0E-130
sp|A4G086|PDXS_METM5 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pdxS PE=3 SV=1 16 304 7.0E-130
sp|A8LWZ4|PDXS_SALAI Pyridoxal 5'-phosphate synthase subunit PdxS OS=Salinispora arenicola (strain CNS-205) GN=pdxS PE=3 SV=1 16 305 7.0E-130
sp|Q5YTD8|PDXS_NOCFA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Nocardia farcinica (strain IFM 10152) GN=pdxS PE=3 SV=1 16 304 2.0E-129
sp|A6UWM0|PDXS_META3 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pdxS PE=3 SV=1 16 304 2.0E-129
sp|A8FAD5|PDXS_BACP2 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus pumilus (strain SAFR-032) GN=pdxS PE=3 SV=1 16 304 3.0E-129
sp|Q3Z9H3|PDXS_DEHM1 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=pdxS PE=3 SV=1 13 304 1.0E-128
sp|Q6AFB9|PDXS_LEIXX Pyridoxal 5'-phosphate synthase subunit PdxS OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pdxS PE=3 SV=1 8 304 2.0E-128
sp|A6UR91|PDXS_METVS Pyridoxal 5'-phosphate synthase subunit PdxS OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pdxS PE=3 SV=1 16 304 2.0E-128
sp|B1KYX5|PDXS_CLOBM Pyridoxal 5'-phosphate synthase subunit PdxS OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=pdxS PE=3 SV=1 16 304 1.0E-127
sp|Q65PL2|PDXS_BACLD Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pdxS PE=3 SV=1 16 304 1.0E-127
sp|B7GFL8|PDXS_ANOFW Pyridoxal 5'-phosphate synthase subunit PdxS OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=pdxS PE=3 SV=1 16 304 1.0E-127
sp|P37527|PDXS_BACSU Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus subtilis (strain 168) GN=pdxS PE=1 SV=3 16 304 1.0E-127
sp|B3DT80|PDXS_BIFLD Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bifidobacterium longum (strain DJO10A) GN=pdxS PE=3 SV=1 19 295 2.0E-127
sp|C5D337|PDXS_GEOSW Pyridoxal 5'-phosphate synthase subunit PdxS OS=Geobacillus sp. (strain WCH70) GN=pdxS PE=3 SV=1 16 304 3.0E-127
sp|Q5L3Y2|PDXS_GEOKA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Geobacillus kaustophilus (strain HTA426) GN=pdxS PE=1 SV=1 16 304 9.0E-127
sp|B7GUB5|PDXS_BIFLS Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=pdxS PE=3 SV=1 19 295 2.0E-126
sp|Q8G574|PDXS_BIFLO Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bifidobacterium longum (strain NCC 2705) GN=pdxS PE=3 SV=2 19 295 2.0E-126
sp|A7Z0D3|PDXS_BACMF Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=pdxS PE=3 SV=1 16 304 2.0E-126
sp|Q9RUL7|PDXS_DEIRA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pdxS PE=3 SV=1 16 304 2.0E-126
sp|Q73WF0|PDXS_MYCPA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pdxS PE=3 SV=1 2 304 2.0E-126
sp|A0QIC8|PDXS_MYCA1 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Mycobacterium avium (strain 104) GN=pdxS PE=3 SV=1 2 304 2.0E-126
sp|Q24PK7|PDXS_DESHY Pyridoxal 5'-phosphate synthase subunit PdxS OS=Desulfitobacterium hafniense (strain Y51) GN=pdxS PE=3 SV=1 11 290 2.0E-126
sp|B8FZR3|PDXS_DESHD Pyridoxal 5'-phosphate synthase subunit PdxS OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=pdxS PE=3 SV=1 11 290 2.0E-126
sp|A4IJ94|PDXS_GEOTN Pyridoxal 5'-phosphate synthase subunit PdxS OS=Geobacillus thermodenitrificans (strain NG80-2) GN=pdxS PE=3 SV=1 16 304 5.0E-126
sp|A1A3A5|PDXS_BIFAA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=pdxS PE=3 SV=1 16 304 6.0E-126
sp|A4X5V3|PDXS_SALTO Pyridoxal 5'-phosphate synthase subunit PdxS OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=pdxS PE=3 SV=1 16 305 7.0E-126
sp|B9IYH8|PDXS_BACCQ Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus cereus (strain Q1) GN=pdxS PE=3 SV=1 16 304 2.0E-125
sp|A0QWG8|PDXS_MYCS2 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pdxS PE=3 SV=1 6 304 2.0E-125
sp|P9WII9|PDXS_MYCTU Pyridoxal 5'-phosphate synthase subunit PdxS OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pdxS PE=1 SV=1 4 304 2.0E-125
sp|P9WII8|PDXS_MYCTO Pyridoxal 5'-phosphate synthase subunit PdxS OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pdxS PE=3 SV=1 4 304 2.0E-125
sp|A5U5V7|PDXS_MYCTA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pdxS PE=3 SV=1 4 304 2.0E-125
sp|C1AF77|PDXS_MYCBT Pyridoxal 5'-phosphate synthase subunit PdxS OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=pdxS PE=3 SV=1 4 304 2.0E-125
sp|A1KLV6|PDXS_MYCBP Pyridoxal 5'-phosphate synthase subunit PdxS OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pdxS PE=3 SV=1 4 304 2.0E-125
sp|P60795|PDXS_MYCBO Pyridoxal 5'-phosphate synthase subunit PdxS OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pdxS PE=3 SV=1 4 304 2.0E-125
sp|B8DWP6|PDXS_BIFA0 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=pdxS PE=3 SV=1 16 294 3.0E-125
sp|P60799|PDXS_STAAW Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus aureus (strain MW2) GN=pdxS PE=3 SV=1 16 304 4.0E-125
sp|A8YZL5|PDXS_STAAT Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pdxS PE=3 SV=1 16 304 4.0E-125
sp|Q6GBW9|PDXS_STAAS Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus aureus (strain MSSA476) GN=pdxS PE=3 SV=1 16 304 4.0E-125
sp|Q6GJF0|PDXS_STAAR Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus aureus (strain MRSA252) GN=pdxS PE=3 SV=1 16 304 4.0E-125
sp|P60798|PDXS_STAAN Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus aureus (strain N315) GN=pdxS PE=1 SV=1 16 304 4.0E-125
sp|P60797|PDXS_STAAM Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdxS PE=3 SV=1 16 304 4.0E-125
sp|A6QEH1|PDXS_STAAE Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus aureus (strain Newman) GN=pdxS PE=3 SV=1 16 304 4.0E-125
sp|Q5HIF5|PDXS_STAAC Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus aureus (strain COL) GN=pdxS PE=3 SV=1 16 304 4.0E-125
sp|A5IQ72|PDXS_STAA9 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus aureus (strain JH9) GN=pdxS PE=3 SV=1 16 304 4.0E-125
sp|Q2G0Q1|PDXS_STAA8 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus aureus (strain NCTC 8325) GN=pdxS PE=3 SV=1 16 304 4.0E-125
sp|Q2FJC1|PDXS_STAA3 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus aureus (strain USA300) GN=pdxS PE=3 SV=1 16 304 4.0E-125
sp|A6TYZ5|PDXS_STAA2 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus aureus (strain JH1) GN=pdxS PE=3 SV=1 16 304 4.0E-125
sp|A7WYT1|PDXS_STAA1 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=pdxS PE=3 SV=1 16 304 4.0E-125
sp|O26762|PDXS_METTH Pyridoxal 5'-phosphate synthase subunit PdxS OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pdxS PE=3 SV=1 16 304 7.0E-125
sp|Q4L3H8|PDXS_STAHJ Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pdxS PE=3 SV=1 16 304 8.0E-125
sp|Q8CQV7|PDXS_STAES Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pdxS PE=3 SV=1 16 304 1.0E-124
sp|Q5HRN5|PDXS_STAEQ Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pdxS PE=3 SV=1 16 304 1.0E-124
sp|A7GH18|PDXS_CLOBL Pyridoxal 5'-phosphate synthase subunit PdxS OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=pdxS PE=3 SV=1 16 304 2.0E-124
sp|Q8EN03|PDXS_OCEIH Pyridoxal 5'-phosphate synthase subunit PdxS OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pdxS PE=3 SV=1 16 304 2.0E-124
sp|O07145|PDXS_MYCLE Pyridoxal 5'-phosphate synthase subunit PdxS OS=Mycobacterium leprae (strain TN) GN=pdxS PE=3 SV=2 9 304 3.0E-124
sp|B8ZUG3|PDXS_MYCLB Pyridoxal 5'-phosphate synthase subunit PdxS OS=Mycobacterium leprae (strain Br4923) GN=pdxS PE=3 SV=1 9 304 3.0E-124
sp|A9VM99|PDXS_BACWK Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus weihenstephanensis (strain KBAB4) GN=pdxS PE=3 SV=1 16 304 3.0E-124
sp|Q6HQ05|PDXS_BACHK Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pdxS PE=3 SV=1 16 304 3.0E-124
sp|Q63HF8|PDXS_BACCZ Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus cereus (strain ZK / E33L) GN=pdxS PE=3 SV=1 16 304 3.0E-124
sp|B7HPS6|PDXS_BACC7 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus cereus (strain AH187) GN=pdxS PE=3 SV=1 16 304 3.0E-124
sp|C1ES17|PDXS_BACC3 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus cereus (strain 03BB102) GN=pdxS PE=3 SV=1 16 304 3.0E-124
sp|Q73FJ5|PDXS_BACC1 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pdxS PE=3 SV=1 16 304 3.0E-124
sp|B7JJC6|PDXS_BACC0 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus cereus (strain AH820) GN=pdxS PE=3 SV=1 16 304 3.0E-124
sp|A7GJS8|PDXS_BACCN Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pdxS PE=3 SV=1 16 304 5.0E-124
sp|Q81W27|PDXS_BACAN Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus anthracis GN=pdxS PE=3 SV=1 16 304 5.0E-124
sp|C3LIY7|PDXS_BACAC Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pdxS PE=3 SV=1 16 304 5.0E-124
sp|C3P8Q3|PDXS_BACAA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus anthracis (strain A0248) GN=pdxS PE=3 SV=1 16 304 5.0E-124
sp|Q81JC6|PDXS_BACCR Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pdxS PE=3 SV=2 16 304 2.0E-123
sp|B7HII3|PDXS_BACC4 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus cereus (strain B4264) GN=pdxS PE=3 SV=1 16 304 2.0E-123
sp|Q2NI73|PDXS_METST Pyridoxal 5'-phosphate synthase subunit PdxS OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pdxS PE=3 SV=1 16 305 2.0E-123
sp|Q97LG7|PDXS_CLOAB Pyridoxal 5'-phosphate synthase subunit PdxS OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pdxS PE=3 SV=1 11 304 3.0E-123
sp|Q9CLJ6|PDXS_PASMU Pyridoxal 5'-phosphate synthase subunit PdxS OS=Pasteurella multocida (strain Pm70) GN=pdxS PE=3 SV=1 8 304 4.0E-123
sp|B7IS29|PDXS_BACC2 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus cereus (strain G9842) GN=pdxS PE=3 SV=1 16 304 5.0E-123
sp|Q5WKW2|PDXS_BACSK Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus clausii (strain KSM-K16) GN=pdxS PE=3 SV=1 16 304 5.0E-123
sp|Q6A948|PDXS_PROAC Pyridoxal 5'-phosphate synthase subunit PdxS OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=pdxS PE=3 SV=1 1 304 7.0E-123
sp|Q6MEN8|PDXS_PARUW Pyridoxal 5'-phosphate synthase subunit PdxS OS=Protochlamydia amoebophila (strain UWE25) GN=pdxS PE=3 SV=1 11 304 8.0E-123
sp|Q8TQH6|PDXS_METAC Pyridoxal 5'-phosphate synthase subunit PdxS OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pdxS PE=3 SV=2 16 304 2.0E-122
sp|A2SPJ9|PDXS_METLZ Pyridoxal 5'-phosphate synthase subunit PdxS OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pdxS PE=3 SV=1 20 294 3.0E-122
sp|B9DKX7|PDXS_STACT Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus carnosus (strain TM300) GN=pdxS PE=3 SV=1 16 304 9.0E-122
sp|P60800|PDXS_CORDI Pyridoxal 5'-phosphate synthase subunit PdxS OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=pdxS PE=3 SV=1 16 304 9.0E-122
sp|Q8PUA5|PDXS_METMA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pdxS PE=3 SV=1 16 304 1.0E-121
sp|Q49V28|PDXS_STAS1 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pdxS PE=3 SV=1 16 304 1.0E-121
sp|P43545|SNZ3_YEAST Probable pyridoxal 5'-phosphate synthase subunit SNZ3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNZ3 PE=2 SV=1 12 295 2.0E-121
sp|P53824|SNZ2_YEAST Probable pyridoxal 5'-phosphate synthase subunit SNZ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNZ2 PE=1 SV=1 12 295 2.0E-121
sp|Q929R9|PDXS_LISIN Pyridoxal 5'-phosphate synthase subunit PdxS OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pdxS PE=3 SV=1 16 303 3.0E-121
sp|Q8Y5G2|PDXS_LISMO Pyridoxal 5'-phosphate synthase subunit PdxS OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pdxS PE=3 SV=1 16 303 4.0E-121
sp|B8DH17|PDXS_LISMH Pyridoxal 5'-phosphate synthase subunit PdxS OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=pdxS PE=3 SV=1 16 303 4.0E-121
sp|Q71XR3|PDXS_LISMF Pyridoxal 5'-phosphate synthase subunit PdxS OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pdxS PE=3 SV=1 16 303 4.0E-121
sp|C1KX53|PDXS_LISMC Pyridoxal 5'-phosphate synthase subunit PdxS OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=pdxS PE=3 SV=1 16 303 4.0E-121
sp|B9E8T2|PDXS_MACCJ Pyridoxal 5'-phosphate synthase subunit PdxS OS=Macrococcus caseolyticus (strain JCSC5402) GN=pdxS PE=3 SV=1 16 304 6.0E-121
sp|B1VDJ3|PDXS_CORU7 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=pdxS PE=3 SV=1 16 304 7.0E-121
sp|Q03148|SNZ1_YEAST Pyridoxal 5'-phosphate synthase subunit SNZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNZ1 PE=1 SV=1 16 294 8.0E-121
sp|A0AKK8|PDXS_LISW6 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=pdxS PE=3 SV=1 16 303 3.0E-120
sp|A5IJU8|PDXS_THEP1 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=pdxS PE=3 SV=1 10 304 5.0E-120
sp|B0BUD0|PDXS_ACTPJ Pyridoxal 5'-phosphate synthase subunit PdxS OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pdxS PE=3 SV=1 16 304 7.0E-120
sp|P82134|PDXS_CORGL Pyridoxal 5'-phosphate synthase subunit PdxS OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pdxS PE=1 SV=2 11 304 7.0E-120
sp|B1L920|PDXS_THESQ Pyridoxal 5'-phosphate synthase subunit PdxS OS=Thermotoga sp. (strain RQ2) GN=pdxS PE=3 SV=1 10 304 8.0E-120
sp|Q9WYU4|PDXS_THEMA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pdxS PE=1 SV=1 10 304 8.0E-120
sp|Q9KGN6|PDXS_BACHD Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pdxS PE=3 SV=1 16 304 1.0E-119
sp|Q7VL86|PDXS_HAEDU Pyridoxal 5'-phosphate synthase subunit PdxS OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pdxS PE=3 SV=1 16 304 1.0E-119
sp|A3MZT8|PDXS_ACTP2 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pdxS PE=3 SV=1 16 304 1.0E-119
sp|Q8FPJ9|PDXS_COREF Pyridoxal 5'-phosphate synthase subunit PdxS OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=pdxS PE=3 SV=1 17 304 1.0E-119
sp|B5YF85|PDXS_DICT6 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=pdxS PE=3 SV=1 16 304 3.0E-119
sp|C1CQQ0|PDXS_STRZT Pyridoxal 5'-phosphate synthase subunit PdxS OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=pdxS PE=3 SV=1 10 295 4.0E-119
sp|C1CLG7|PDXS_STRZP Pyridoxal 5'-phosphate synthase subunit PdxS OS=Streptococcus pneumoniae (strain P1031) GN=pdxS PE=3 SV=1 10 295 4.0E-119
sp|C1CF50|PDXS_STRZJ Pyridoxal 5'-phosphate synthase subunit PdxS OS=Streptococcus pneumoniae (strain JJA) GN=pdxS PE=3 SV=1 10 295 4.0E-119
sp|Q8DP71|PDXS_STRR6 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pdxS PE=3 SV=2 10 295 4.0E-119
sp|Q97PX2|PDXS_STRPN Pyridoxal 5'-phosphate synthase subunit PdxS OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pdxS PE=3 SV=1 10 295 4.0E-119
sp|B8ZL14|PDXS_STRPJ Pyridoxal 5'-phosphate synthase subunit PdxS OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=pdxS PE=3 SV=1 10 295 4.0E-119
sp|B1ICP9|PDXS_STRPI Pyridoxal 5'-phosphate synthase subunit PdxS OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=pdxS PE=3 SV=1 10 295 4.0E-119
sp|C1C863|PDXS_STRP7 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Streptococcus pneumoniae (strain 70585) GN=pdxS PE=3 SV=1 10 295 4.0E-119
sp|B5E5W1|PDXS_STRP4 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=pdxS PE=3 SV=1 10 295 4.0E-119
sp|Q04JN5|PDXS_STRP2 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=pdxS PE=3 SV=1 10 295 4.0E-119
sp|B3GXB6|PDXS_ACTP7 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pdxS PE=3 SV=1 16 304 5.0E-119
sp|Q8TVL8|PDXS_METKA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pdxS PE=3 SV=1 13 304 1.0E-118
sp|B8E121|PDXS_DICTD Pyridoxal 5'-phosphate synthase subunit PdxS OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=pdxS PE=3 SV=1 16 304 7.0E-118
sp|Q8L1A8|PDXS_BACCI Pyridoxal 5'-phosphate synthase subunit PdxS OS=Bacillus circulans GN=pdxS PE=3 SV=1 16 304 4.0E-117
sp|Q8RDP7|PDXS_FUSNN Pyridoxal 5'-phosphate synthase subunit PdxS OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=pdxS PE=3 SV=1 24 295 6.0E-117
sp|A5UF86|PDXS_HAEIG Pyridoxal 5'-phosphate synthase subunit PdxS OS=Haemophilus influenzae (strain PittGG) GN=pdxS PE=3 SV=1 16 295 6.0E-116
sp|P45293|PDXS_HAEIN Pyridoxal 5'-phosphate synthase subunit PdxS OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pdxS PE=1 SV=1 16 295 7.0E-116
sp|A5UBN2|PDXS_HAEIE Pyridoxal 5'-phosphate synthase subunit PdxS OS=Haemophilus influenzae (strain PittEE) GN=pdxS PE=3 SV=1 16 295 7.0E-116
sp|Q4QJU5|PDXS_HAEI8 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Haemophilus influenzae (strain 86-028NP) GN=pdxS PE=3 SV=1 16 295 7.0E-116
sp|Q83HM5|PDXS_TROW8 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Tropheryma whipplei (strain TW08/27) GN=pdxS PE=3 SV=1 16 304 3.0E-115
sp|Q971B3|PDXS_SULTO Pyridoxal 5'-phosphate synthase subunit PdxS OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pdxS PE=3 SV=2 11 305 6.0E-115
sp|Q83MZ9|PDXS_TROWT Pyridoxal 5'-phosphate synthase subunit PdxS OS=Tropheryma whipplei (strain Twist) GN=pdxS PE=3 SV=1 16 304 1.0E-114
sp|A4YI11|PDXS_METS5 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=pdxS PE=3 SV=1 16 304 2.0E-114
sp|Q58090|PDXS_METJA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pdxS PE=1 SV=1 16 304 3.0E-114
sp|Q73QI7|PDXS_TREDE Pyridoxal 5'-phosphate synthase subunit PdxS OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=pdxS PE=3 SV=1 24 295 5.0E-114
sp|A2BLL5|PDXS_HYPBU Pyridoxal 5'-phosphate synthase subunit PdxS OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=pdxS PE=3 SV=1 16 304 3.0E-113
sp|C3NET6|PDXS_SULIY Pyridoxal 5'-phosphate synthase subunit PdxS OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pdxS PE=3 SV=1 16 304 2.0E-112
sp|C3MW86|PDXS_SULIM Pyridoxal 5'-phosphate synthase subunit PdxS OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pdxS PE=3 SV=1 16 304 2.0E-112
sp|C3MQK8|PDXS_SULIL Pyridoxal 5'-phosphate synthase subunit PdxS OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pdxS PE=3 SV=1 16 304 2.0E-112
sp|C4KHU3|PDXS_SULIK Pyridoxal 5'-phosphate synthase subunit PdxS OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pdxS PE=3 SV=1 16 304 2.0E-112
sp|C3N6C8|PDXS_SULIA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Sulfolobus islandicus (strain M.16.27) GN=pdxS PE=3 SV=1 16 304 2.0E-112
sp|Q4J8L3|PDXS_SULAC Pyridoxal 5'-phosphate synthase subunit PdxS OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pdxS PE=3 SV=1 25 304 2.0E-112
sp|Q9UWX3|PDXS_SULSO Pyridoxal 5'-phosphate synthase subunit PdxS OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pdxS PE=3 SV=1 16 304 2.0E-112
sp|C3NGV8|PDXS_SULIN Pyridoxal 5'-phosphate synthase subunit PdxS OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pdxS PE=3 SV=1 16 304 4.0E-112
sp|A4WHH6|PDXS_PYRAR Pyridoxal 5'-phosphate synthase subunit PdxS OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=pdxS PE=3 SV=1 13 304 9.0E-112
sp|O69190|PDXS_FRATU Pyridoxal 5'-phosphate synthase subunit PdxS (Fragment) OS=Francisella tularensis GN=pdxS PE=3 SV=1 12 252 9.0E-112
sp|Q9YFK2|PDXS_AERPE Pyridoxal 5'-phosphate synthase subunit PdxS OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pdxS PE=3 SV=1 13 304 1.0E-111
sp|Q8ZUF0|PDXS_PYRAE Pyridoxal 5'-phosphate synthase subunit PdxS OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pdxS PE=3 SV=1 13 304 3.0E-111
sp|Q3INE8|PDXS_NATPD Pyridoxal 5'-phosphate synthase subunit PdxS OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pdxS PE=3 SV=1 1 304 2.0E-110
sp|Q9HP57|PDXS_HALSA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pdxS PE=3 SV=1 11 304 7.0E-110
sp|B0R6D5|PDXS_HALS3 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pdxS PE=3 SV=1 11 304 7.0E-110
sp|B9LRS6|PDXS_HALLT Pyridoxal 5'-phosphate synthase subunit PdxS OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=pdxS PE=3 SV=1 10 304 2.0E-109
sp|C5A4G9|PDXS_THEGJ Pyridoxal 5'-phosphate synthase subunit PdxS OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pdxS PE=3 SV=1 16 291 4.0E-109
sp|B8D3X7|PDXS_DESK1 Pyridoxal 5'-phosphate synthase subunit PdxS OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=pdxS PE=3 SV=1 16 304 5.0E-109
sp|C6KT50|PDX1_PLAF7 Pyridoxal 5'-phosphate synthase subunit Pdx1 OS=Plasmodium falciparum (isolate 3D7) GN=pdx1 PE=1 SV=1 8 304 1.0E-108
sp|Q18F41|PDXS_HALWD Pyridoxal 5'-phosphate synthase subunit PdxS OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pdxS PE=3 SV=1 11 304 1.0E-108
sp|Q5JFR1|PDXS_THEKO Pyridoxal 5'-phosphate synthase subunit PdxS OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pdxS PE=3 SV=1 16 291 5.0E-108
sp|O29742|PDXS_ARCFU Pyridoxal 5'-phosphate synthase subunit PdxS OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pdxS PE=3 SV=1 16 304 6.0E-108
sp|P0DMS0|PDX1_PLABE Pyridoxal 5'-phosphate synthase subunit Pdx1 OS=Plasmodium berghei GN=pdx1 PE=1 SV=1 13 288 7.0E-108
sp|Q979Y3|PDXS_THEVO Pyridoxal 5'-phosphate synthase subunit PdxS OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pdxS PE=3 SV=1 16 304 4.0E-107
sp|Q5V1G7|PDXS_HALMA Pyridoxal 5'-phosphate synthase subunit PdxS OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pdxS PE=3 SV=1 11 304 9.0E-107
sp|O59080|PDXS_PYRHO Pyridoxal 5'-phosphate synthase subunit PdxS OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pdxS PE=1 SV=1 16 299 1.0E-106
sp|Q9V0J7|PDXS_PYRAB Pyridoxal 5'-phosphate synthase subunit PdxS OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pdxS PE=3 SV=1 16 299 1.0E-106
sp|Q8U0Q6|PDXS_PYRFU Pyridoxal 5'-phosphate synthase subunit PdxS OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pdxS PE=3 SV=1 16 299 1.0E-106
sp|Q6L2D8|PDXS_PICTO Pyridoxal 5'-phosphate synthase subunit PdxS OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=pdxS PE=3 SV=1 16 304 1.0E-106
sp|B6YVQ7|PDXS_THEON Pyridoxal 5'-phosphate synthase subunit PdxS OS=Thermococcus onnurineus (strain NA1) GN=pdxS PE=3 SV=1 16 288 4.0E-106
sp|Q9HKS5|PDXS_THEAC Pyridoxal 5'-phosphate synthase subunit PdxS OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pdxS PE=3 SV=1 16 304 3.0E-104
sp|A3MSN0|PDXS_PYRCJ Pyridoxal 5'-phosphate synthase subunit PdxS OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pdxS PE=3 SV=1 16 304 5.0E-104
sp|Q50841|PDXS_METVA Pyridoxal 5'-phosphate synthase subunit PdxS (Fragment) OS=Methanococcus vannielii GN=pdxS PE=3 SV=1 70 304 5.0E-99
sp|Q84IL8|PDXS_CLONO Pyridoxal 5'-phosphate synthase subunit PdxS (Fragment) OS=Clostridium novyi GN=pdxS PE=3 SV=1 66 294 2.0E-97
sp|Q9ZNR6|PDX12_ARATH Pyridoxal 5'-phosphate synthase-like subunit PDX1.2 OS=Arabidopsis thaliana GN=PDX12 PE=1 SV=1 14 290 2.0E-91
sp|Q41348|PDX1_STELP Probable pyridoxal 5'-phosphate synthase subunit PDX1 (Fragment) OS=Stellaria longipes PE=2 SV=1 73 289 4.0E-76
sp|O80446|PDXL4_ARATH Pyridoxal 5'-phosphate synthase PDX1-like 4 OS=Arabidopsis thaliana GN=PDX1L4 PE=3 SV=1 10 68 5.0E-21
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3339
MANDTAANGSRSSMAVKTGLAQMLKGGVIMDVTTAEQARIAEEAGAIAVMALERVPADIRRDGGVARMSDPAVIT
AIQAAVTIPVMAKARIGHFVECQVLEALGVDYIDESEVLTPADDSSHVDKSPFGVPFVCGCRNLGEALRRIAEGA
AMIRTKGEAGTGDVVEAVRHIKTLNRDVGRAKEALAAGGMPRIRELARELEVDAELLRQTAELGRLPVVNFAAGG
VATPADAALMMQLGCDGVFVGSGIFKSGDPAKRAKAIVRATTHFNDAQVLAECSTGLGEAMVGIDCDSMRPDERL
AGRGR
Coding >Ophio5|3339
ATGGCCAACGATACTGCTGCTAACGGCTCCCGCTCGTCCATGGCCGTCAAGACGGGCCTCGCTCAAATGCTCAAG
GGCGGCGTCATCATGGACGTGACGACGGCCGAGCAAGCCCGCATCGCCGAGGAGGCCGGAGCCATCGCCGTCATG
GCTCTCGAGCGCGTCCCGGCAGACATCCGGCGCGACGGCGGCGTGGCCCGCATGTCGGATCCGGCCGTCATCACC
GCCATTCAAGCTGCCGTTACCATTCCCGTCATGGCAAAGGCTCGCATCGGCCACTTCGTCGAGTGCCAGGTGCTC
GAGGCGCTGGGCGTCGACTACATCGATGAGAGCGAGGTCCTGACGCCGGCCGACGATTCGAGCCACGTCGACAAG
AGTCCCTTTGGCGTGCCCTTTGTCTGCGGCTGTCGCAACCTTGGCGAGGCCCTGCGCCGAATTGCCGAGGGCGCG
GCCATGATACGCACAAAGGGCGAGGCCGGCACTGGCGACGTCGTCGAGGCCGTCCGACACATCAAGACGCTCAAC
CGTGACGTGGGCCGCGCAAAGGAGGCTCTTGCCGCCGGCGGCATGCCTCGCATCCGAGAGTTGGCCCGCGAACTC
GAGGTCGACGCCGAGCTGCTTCGCCAGACTGCTGAGCTTGGCCGGCTGCCCGTCGTCAACTTTGCGGCTGGAGGC
GTCGCCACCCCGGCCGATGCCGCCCTCATGATGCAGCTCGGCTGCGATGGCGTCTTCGTCGGCAGCGGCATCTTC
AAGTCGGGCGATCCGGCCAAGCGCGCCAAGGCCATTGTCCGGGCCACTACTCACTTCAATGACGCCCAGGTTCTT
GCCGAGTGCAGCACTGGCCTGGGCGAGGCCATGGTCGGCATCGACTGCGATTCCATGCGGCCCGACGAGAGGCTG
GCCGGCCGCGGTCGT
Transcript >Ophio5|3339
ATGGCCAACGATACTGCTGCTAACGGCTCCCGCTCGTCCATGGCCGTCAAGACGGGCCTCGCTCAAATGCTCAAG
GGCGGCGTCATCATGGACGTGACGACGGCCGAGCAAGCCCGCATCGCCGAGGAGGCCGGAGCCATCGCCGTCATG
GCTCTCGAGCGCGTCCCGGCAGACATCCGGCGCGACGGCGGCGTGGCCCGCATGTCGGATCCGGCCGTCATCACC
GCCATTCAAGCTGCCGTTACCATTCCCGTCATGGCAAAGGCTCGCATCGGCCACTTCGTCGAGTGCCAGGTGCTC
GAGGCGCTGGGCGTCGACTACATCGATGAGAGCGAGGTCCTGACGCCGGCCGACGATTCGAGCCACGTCGACAAG
AGTCCCTTTGGCGTGCCCTTTGTCTGCGGCTGTCGCAACCTTGGCGAGGCCCTGCGCCGAATTGCCGAGGGCGCG
GCCATGATACGCACAAAGGGCGAGGCCGGCACTGGCGACGTCGTCGAGGCCGTCCGACACATCAAGACGCTCAAC
CGTGACGTGGGCCGCGCAAAGGAGGCTCTTGCCGCCGGCGGCATGCCTCGCATCCGAGAGTTGGCCCGCGAACTC
GAGGTCGACGCCGAGCTGCTTCGCCAGACTGCTGAGCTTGGCCGGCTGCCCGTCGTCAACTTTGCGGCTGGAGGC
GTCGCCACCCCGGCCGATGCCGCCCTCATGATGCAGCTCGGCTGCGATGGCGTCTTCGTCGGCAGCGGCATCTTC
AAGTCGGGCGATCCGGCCAAGCGCGCCAAGGCCATTGTCCGGGCCACTACTCACTTCAATGACGCCCAGGTTCTT
GCCGAGTGCAGCACTGGCCTGGGCGAGGCCATGGTCGGCATCGACTGCGATTCCATGCGGCCCGACGAGAGGCTG
GCCGGCCGCGGTCGTTGA
Gene >Ophio5|3339
ATGGCCAACGATACTGCTGCTAACGGCTCCCGCTCGTCCATGGCCGTCAAGACGGGCCTCGCTCAAATGCTCAAG
GGCGGCGTCATCATGGACGTGACGACGGCCGAGCAAGCCCGCATCGCCGAGGAGGCCGGAGCCATCGCCGTCATG
GCTCTCGAGCGCGTCCCGGCAGACATCCGGCGCGACGGCGGCGTGGCCCGCATGTCGGATCCGGCCGTCATCACC
GCCATTCAAGCTGCCGTTACCATTCCCGTCATGGCAAAGGCTCGCATCGGCCACTTCGTCGAGTGCCAGGTGCTC
GAGGCGCTGGGCGTCGACTACATCGATGAGAGCGAGGTCCTGACGCCGGCCGACGATTCGAGCCACGTCGACAAG
AGTCCCTTTGGCGTGCCCTTTGTCTGCGGCTGTCGCAACCTTGGCGAGGCCCTGCGCCGAATTGCCGAGGGCGCG
GCCATGATACGCACAAAGGGCGAGGCCGGCACTGGCGACGTCGTCGAGGCCGTCCGACACATCAAGACGCTCAAC
CGTGACGTGGGCCGCGCAAAGGAGGCTCTTGCCGCCGGCGGCATGCCTCGCATCCGAGAGTTGGCCCGCGAACTC
GAGGTCGACGCCGAGCTGCTTCGCCAGACTGCTGAGCTTGGCCGGCTGCCCGTCGTCAACTTTGCGGCTGGAGGC
GTCGCCACCCCGGCCGATGCCGCCCTCATGATGCAGCTCGGCTGCGATGGCGTCTTCGTCGGCAGCGGCATCTTC
AAGTCGGGCGATCCGGCCAAGCGCGCCAAGGCCATTGTCCGGGCCACTACTCACTTCAATGACGCCCAGGTTCTT
GCCGAGTGCAGCACTGGCCTGGGCGAGGCCATGGTCGGCATCGACTGCGATTCCATGCGGCCCGACGAGAGGCTG
GCCGGCCGCGGTCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail