Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3334
Gene name
Locationscaffold_264:17161..18134
Strand+
Gene length (bp)973
Transcript length (bp)801
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04777 Evr1_Alr Erv1 / Alr family 1.1E-29 96 182

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12284|ERV2_YEAST FAD-linked sulfhydryl oxidase ERV2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV2 PE=1 SV=1 76 206 1.0E-38
sp|P56213|ALR_MOUSE FAD-linked sulfhydryl oxidase ALR OS=Mus musculus GN=Gfer PE=1 SV=2 91 187 3.0E-26
sp|Q63042|ALR_RAT FAD-linked sulfhydryl oxidase ALR OS=Rattus norvegicus GN=Gfer PE=1 SV=2 91 187 6.0E-26
sp|Q8GXX0|ERV1_ARATH FAD-linked sulfhydryl oxidase ERV1 OS=Arabidopsis thaliana GN=ERV1 PE=1 SV=1 91 183 2.0E-24
sp|O14144|ERV1_SCHPO Mitochondrial FAD-linked sulfhydryl oxidase erv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv1 PE=3 SV=1 53 180 5.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12284|ERV2_YEAST FAD-linked sulfhydryl oxidase ERV2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV2 PE=1 SV=1 76 206 1.0E-38
sp|P56213|ALR_MOUSE FAD-linked sulfhydryl oxidase ALR OS=Mus musculus GN=Gfer PE=1 SV=2 91 187 3.0E-26
sp|Q63042|ALR_RAT FAD-linked sulfhydryl oxidase ALR OS=Rattus norvegicus GN=Gfer PE=1 SV=2 91 187 6.0E-26
sp|Q8GXX0|ERV1_ARATH FAD-linked sulfhydryl oxidase ERV1 OS=Arabidopsis thaliana GN=ERV1 PE=1 SV=1 91 183 2.0E-24
sp|O14144|ERV1_SCHPO Mitochondrial FAD-linked sulfhydryl oxidase erv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv1 PE=3 SV=1 53 180 5.0E-24
sp|P55789|ALR_HUMAN FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens GN=GFER PE=1 SV=2 91 187 5.0E-23
sp|P27882|ERV1_YEAST Mitochondrial FAD-linked sulfhydryl oxidase ERV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV1 PE=1 SV=2 63 181 7.0E-23
sp|Q9Y806|ERV2_SCHPO FAD-linked sulfhydryl oxidase erv2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv2 PE=3 SV=1 1 190 2.0E-19
sp|Q5UQV6|YR368_MIMIV Probable FAD-linked sulfhydryl oxidase R368 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R368 PE=3 SV=1 93 170 6.0E-07
sp|Q5UP54|YR596_MIMIV Probable FAD-linked sulfhydryl oxidase R596 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R596 PE=1 SV=1 86 174 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016972 thiol oxidase activity Yes
GO:0016491 oxidoreductase activity No
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor No
GO:0003824 catalytic activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 89.55 48.12 130.99
CcL In ants, during behavior modification 67.22 33.00 101.44
CcD In ants, recently dead 58.34 28.94 87.75

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.249826 no
SC16a CcD 0.075972 no
CcL CcD 0.622618 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3334
MARRTHITLMLLLGLAFLFSISYLYSGPGSLTARDAARLLNKVRSRPPQAPLSNTDAGSKGDAESGFKPGLPDAL
LDGDSIAPKLENATLKAELGRATWKFLHTMVAKYPEKPTPEDRQTLQFFFVYFGKLYPCGDCARHFRGLLKKMPP
QTSSRNSAAGWLCEVHNQVNKRLEKPIFDCNNIGDFYDCGCAEDKKNDKKKEKKDKLTRFILPTPIHARWFDTDE
LAKPNIEAVQRSRDANNGQRIATRDYGRHQWGQLGAAARVL
Coding >Ophio5|3334
ATGGCGCGCCGAACGCACATCACCCTGATGCTCCTCCTGGGCCTGGCGTTTCTCTTCAGCATCTCTTATCTTTAC
TCTGGGCCGGGCTCCTTGACGGCGCGCGATGCCGCTCGACTGTTGAATAAGGTCCGCAGCAGGCCTCCTCAGGCG
CCCCTCTCCAACACCGACGCCGGATCAAAAGGCGACGCCGAGTCGGGCTTCAAGCCGGGTCTTCCTGACGCCCTG
CTGGACGGCGACTCCATCGCGCCCAAGCTGGAAAATGCAACCTTGAAAGCCGAGCTGGGTCGCGCCACATGGAAG
TTCCTTCACACCATGGTGGCCAAGTACCCCGAGAAGCCGACACCTGAAGACCGCCAGACGCTGCAGTTTTTCTTC
GTCTACTTTGGCAAGCTGTATCCTTGCGGCGACTGCGCGAGGCACTTCCGGGGCCTGCTCAAGAAGATGCCGCCC
CAGACAAGCAGCCGCAACTCGGCGGCGGGCTGGTTATGCGAGGTACACAACCAGGTCAACAAGCGACTAGAAAAG
CCCATCTTTGACTGCAACAACATTGGTGACTTTTACGATTGCGGCTGCGCAGAAGATAAAAAGAATGACAAGAAG
AAGGAAAAGAAGGATAAATTGACTCGCTTTATTCTACCAACACCGATCCACGCACGATGGTTTGACACTGATGAG
CTCGCCAAACCAAACATTGAGGCAGTGCAACGATCACGTGATGCGAATAATGGCCAGCGAATTGCAACACGTGAC
TACGGAAGACACCAATGGGGGCAGCTTGGCGCGGCTGCGCGCGTTCTC
Transcript >Ophio5|3334
ATGGCGCGCCGAACGCACATCACCCTGATGCTCCTCCTGGGCCTGGCGTTTCTCTTCAGCATCTCTTATCTTTAC
TCTGGGCCGGGCTCCTTGACGGCGCGCGATGCCGCTCGACTGTTGAATAAGGTCCGCAGCAGGCCTCCTCAGGCG
CCCCTCTCCAACACCGACGCCGGATCAAAAGGCGACGCCGAGTCGGGCTTCAAGCCGGGTCTTCCTGACGCCCTG
CTGGACGGCGACTCCATCGCGCCCAAGCTGGAAAATGCAACCTTGAAAGCCGAGCTGGGTCGCGCCACATGGAAG
TTCCTTCACACCATGGTGGCCAAGTACCCCGAGAAGCCGACACCTGAAGACCGCCAGACGCTGCAGTTTTTCTTC
GTCTACTTTGGCAAGCTGTATCCTTGCGGCGACTGCGCGAGGCACTTCCGGGGCCTGCTCAAGAAGATGCCGCCC
CAGACAAGCAGCCGCAACTCGGCGGCGGGCTGGTTATGCGAGGTACACAACCAGGTCAACAAGCGACTAGAAAAG
CCCATCTTTGACTGCAACAACATTGGTGACTTTTACGATTGCGGCTGCGCAGAAGATAAAAAGAATGACAAGAAG
AAGGAAAAGAAGGATAAATTGACTCGCTTTATTCTACCAACACCGATCCACGCACGATGGTTTGACACTGATGAG
CTCGCCAAACCAAACATTGAGGCAGTGCAACGATCACGTGATGCGAATAATGGCCAGCGAATTGCAACACGTGAC
TACGGAAGACACCAATGGGGGCAGCTTGGCGCGGCTGCGCGCGTTCTCTGA
Gene >Ophio5|3334
ATGGCGCGCCGAACGCACATCACCCTGATGCTCCTCCTGGGCCTGGCGTTTCTCTTCAGCATCTCTTATCTTTAC
TCTGGGCCGGGCTCCTTGACGGCGCGCGATGCCGCTCGACTGTTGAATAAGGTCCGCAGCAGGCCTCCTCAGGCG
CCCCTCTCCAACACCGACGCCGGATCAAAAGGCGACGCCGAGTCGGGCTTCAAGCCGGGTCTTCCTGACGCCCTG
CTGGACGGCGACTCCATCGCGCCCAAGCTGGAAAATGCAACCTTGAAGTGAGGCTCACTGCCCCTCCTTCACCGT
CTCACATGTCTCCAACGGGTCTCTGACGTCGATGCGATAGAGCCGAGCTGGGTCGCGCCACATGGAAGTTCCTTC
ACACCATGGTGGCCAAGTACCCCGAGAAGCCGACACCTGAAGACCGCCAGACGCTGCAGTTTTTCTTCGTCTACT
TTGGCAAGCTGTATCCTTGCGGCGACTGCGCGAGGCACTTCCGGGGCCTGCTCAAGAAGATGCCGCCCCAGACAA
GCAGCCGCAACTCGGCGGCGGGCTGGTTATGCGAGGTACACAACCAGGTCAACAAGCGACTAGAAAAGCCCATCT
TTGACTGCAACAACATTGGTGACTTTTACGATTGCGGCTGCGCAGAAGATAAAAAGAATGACAAGAAGAAGGAAA
AGAAGGATAAGTAAGAGGCGGTTAACCAGGCGTCTTGGTCAGGGAGCGTTTGAACACGACTTTTACGTTAGGATA
GACTCTGGAGTTTGCGTTCAAAGTATTACTATAGCATAGATTGACTCGCTTTATTCTACCAACACCGATCCACGC
ACGATGGTTTGACACTGATGAGCTCGCCAAACCAAACATTGAGGCAGTGCAACGATCACGTGATGCGAATAATGG
CCAGCGAATTGCAACACGTGACTACGGAAGACACCAATGGGGGCAGCTTGGCGCGGCTGCGCGCGTTCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail