Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3333
Gene name
Locationscaffold_264:8511..12763
Strand-
Gene length (bp)4252
Transcript length (bp)4065
Coding sequence length (bp)4062
Protein length (aa) 1354

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 1247 1269 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 113.12 51.08 175.17
CcL In ants, during behavior modification 154.02 34.78 273.27
CcD In ants, recently dead 95.40 44.67 146.13

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.373980 no
SC16a CcD 0.556967 no
CcL CcD 0.156502 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3333
MSVATQLNHIFSRLTSLRYRSFTYRASSTFVASILTHTAKSIVLLRYHFVDDPSIYLILPKSNAVIVALALIGIV
AAGPDPEQPHIYFPRNEVTRQTFNSTSSTSHILTTTENGLSTDPDSSSSSLHLLDELVSSLLRSATEATSSDRLD
DSIVTPVGPPALTDAPSGTGGLPYATVASTSIKSMIGSTQRPEPTRQDGTQEPSSVKPNFGSTQRQQPSSQDDTH
RSSSDKSEPGSTSRPGPSSQDGTQRSSSDKLESGSTQRPQPSSQVDTQRPSSDKLESGSTQRPQPSSQVGTQSSS
DKLESGSTQRPQPSSQVGTQSSSDKPDFGSTSNAAPSSQGTLQRPSSDKPEFGSTSRPASSSQGTIQRSSLDKTE
PGSTQRPELSSHDSSNKSSTRQHEAASTYKPGPSSYASPQASTSGKPEPTSTSRSDPTRHSHLDLPSDAGIVIGP
NGIVTPTPSSSSRLRDDSSDSRPPTTGHSAEPSVTENETQAQSSATGEVKAAKPPVVGLRKGTKSPATDKGPELP
GADGSLAPTPRVNGSSLQPNEPSTTSSSTKDGILAPVGNLASGLLPVPTANTVSSASSAVYSSAPTSVPTTKAGL
SAPSDVDGNRPIPIPSISDVFSRPGGTAVRTTSASASSTETSIPSSVITSIENVAPTTSRTAHLPDSDGVVSSPT
SRSDSTEPEETSTNGLLPAVTSKAAALTSLVPAVNSILPPPANSTAPSTLSNLTVGSTSSVSDPTIPPPIPVLPT
GTAPTATSTSSVPTPVSSSDRDIAADTFMSSNSSAAYTPPETASPTKSDGLLPLVTSLLLTQTSSTAQTSSDLPL
NTTLAVLPTATSQPPTLTSGLFNATTASTVAEVPVTSATSTQITSSSQTAETSGPPTIAPVTNATSSVEPSSQSL
KPTLNTTSTLEPTVSSTGPATTELLLTTSVANTTEAASKTTSLYRFPHSSPSIHTASSSSSLSSLHPTTTVGSIM
TSDRPSLTAVTTERKPSLTAVTTERKPSSTVVTTERKPSSTVVTTERKPSSTVVSQQLPTSSSASQPPSEAPQPA
PTNFPKYIAPSKPAALAPVGTRNITIALNNIVMYNEIDIISTFNITSRLLPSLLSLSLAPRSADKIVIFSLERCV
DSVQPFSVLAHTSFPDDDGFVRQLQLNLGLANSPIYTTDAAELTKVIEKNLKASGQSITPTDTQAALKLRDNLDK
FHNITVEHCVARGSEKGATSGGDLGSNGDVQNAPNPGNQTEKEKLTTMGVAFGVVGAGFMYGAAMFIIARRYKRK
RQTHRRSSSVSNSQDSSEMQQAGGASPPLMGGALPSRDYFSYGAEGRDSRGSGRSGMANSGRTANISAPVAAENS
LGWN
Coding >Ophio5|3333
ATGTCAGTCGCGACACAGCTCAACCACATCTTCAGTCGGCTAACGTCCCTTAGATATCGCTCGTTCACATATCGC
GCGTCAAGTACATTCGTTGCATCTATCCTGACACATACGGCAAAGTCCATCGTCCTTTTGCGATACCATTTTGTT
GACGATCCATCAATTTACTTGATATTACCAAAATCGAACGCTGTCATCGTGGCATTGGCCTTGATCGGAATCGTT
GCGGCCGGACCAGACCCCGAACAGCCTCACATCTACTTCCCTCGCAATGAAGTCACGCGCCAAACCTTCAATTCG
ACTTCCTCCACCTCCCACATCCTGACCACGACGGAAAACGGGCTCTCGACCGATCCCGACAGCTCTTCCTCGAGC
CTACACCTACTCGACGAGCTCGTTTCCAGCCTTCTTCGCTCCGCCACCGAAGCAACCTCTAGCGACCGACTCGAT
GACTCGATTGTGACGCCCGTCGGCCCTCCCGCTCTCACAGATGCGCCGAGTGGTACCGGCGGTTTGCCCTACGCC
ACCGTAGCTTCAACGTCCATCAAGTCTATGATTGGGTCGACCCAGAGACCGGAGCCAACCAGACAAGACGGCACC
CAGGAACCATCTTCAGTCAAGCCTAATTTCGGCTCGACGCAGAGGCAGCAACCGTCCAGCCAGGACGACACCCAT
AGATCGTCCTCCGACAAGTCGGAACCGGGGTCAACGTCCAGGCCGGGGCCATCCAGCCAGGATGGCACGCAGAGG
TCTTCATCCGACAAGCTTGAGTCTGGCTCGACACAGAGACCGCAGCCGTCCAGCCAGGTTGACACGCAGAGGCCT
TCATCCGACAAGCTTGAGTCTGGCTCGACGCAGAGGCCACAGCCGTCCAGCCAGGTTGGCACGCAGAGTTCATCC
GACAAGCTTGAGTCTGGCTCGACACAGAGGCCGCAGCCGTCCAGCCAGGTTGGCACGCAGAGTTCATCCGACAAG
CCTGACTTCGGCTCGACGTCCAACGCGGCACCGTCCAGCCAAGGCACTCTCCAGAGACCCTCATCCGATAAGCCT
GAGTTCGGCTCGACGTCCAGGCCGGCATCGTCCAGCCAAGGCACTATCCAGAGATCGTCTTTGGATAAAACCGAG
CCCGGCTCGACGCAGAGACCCGAGTTGTCCAGCCACGACAGCAGCAATAAATCGTCGACGAGGCAGCATGAGGCA
GCGTCGACGTACAAACCGGGACCGTCCAGTTACGCAAGCCCCCAGGCATCGACATCCGGCAAGCCTGAGCCAACT
TCGACCTCAAGATCGGATCCTACCCGCCACAGCCACCTCGATCTGCCGTCCGACGCCGGCATTGTGATTGGCCCC
AACGGCATTGTCACGCCAACTCCCAGCTCAAGCTCCAGGCTCAGAGACGACTCTTCGGATTCGCGTCCGCCGACC
ACCGGCCACAGCGCTGAACCGTCCGTCACTGAAAACGAAACTCAAGCCCAGTCGTCCGCCACCGGCGAGGTCAAG
GCCGCCAAGCCGCCTGTCGTAGGCCTCAGAAAAGGCACCAAGTCGCCTGCCACAGACAAGGGGCCCGAGCTGCCC
GGCGCCGACGGCAGCTTGGCTCCGACTCCGCGGGTCAATGGCTCCTCGCTACAGCCTAATGAGCCGTCGACAACA
TCCTCGAGTACCAAAGATGGCATCCTGGCTCCCGTCGGCAACCTCGCGAGCGGACTGTTACCGGTCCCGACAGCC
AACACTGTTTCTTCTGCGTCTTCGGCCGTCTACAGCAGCGCTCCTACATCTGTCCCGACAACCAAGGCTGGCTTG
TCTGCCCCCAGCGACGTCGATGGCAACCGTCCGATTCCGATCCCGAGCATTAGCGACGTCTTCTCGCGTCCCGGG
GGCACCGCCGTCCGCACCACTTCGGCGTCAGCTTCGTCGACCGAGACAAGTATCCCGAGTTCCGTGATCACTTCC
ATTGAGAACGTGGCACCGACCACCAGCCGGACGGCTCACCTCCCGGACTCTGACGGTGTTGTCTCGTCTCCGACA
TCCCGCTCAGACAGCACTGAGCCCGAGGAGACGTCAACCAACGGTCTTCTTCCGGCTGTGACATCAAAGGCTGCT
GCTCTGACTTCTCTGGTGCCCGCGGTCAACAGTATCCTGCCCCCCCCTGCCAACTCGACTGCGCCTTCGACCCTT
TCGAACCTGACGGTGGGTTCAACGAGCTCCGTTTCGGACCCGACGATACCGCCGCCCATTCCCGTCTTGCCTACC
GGCACGGCACCGACAGCCACCTCCACTTCGAGCGTACCAACCCCTGTGAGCTCTTCTGACAGGGACATTGCTGCA
GACACCTTCATGTCTTCAAACTCGTCCGCAGCGTACACGCCGCCCGAGACGGCCTCTCCAACCAAGTCCGACGGA
CTGCTGCCGCTTGTCACCTCGCTGCTACTGACACAGACGTCCTCGACGGCGCAGACTTCGTCCGATTTGCCACTC
AACACGACGCTTGCCGTGCTGCCCACGGCTACAAGCCAGCCACCCACACTAACCTCTGGCCTCTTCAACGCCACC
ACTGCTAGCACTGTTGCCGAGGTCCCGGTGACAAGTGCGACGAGCACCCAGATCACAAGCAGCTCCCAGACGGCA
GAAACCAGTGGCCCACCCACCATTGCGCCCGTGACGAATGCCACAAGCTCGGTCGAGCCTTCCAGCCAGTCCTTG
AAGCCAACCCTCAATACCACCAGCACGTTGGAGCCGACTGTTTCTTCGACCGGACCAGCCACCACCGAGCTGCTG
TTGACGACTTCTGTCGCGAATACAACCGAGGCGGCATCCAAAACGACGTCGCTGTACCGCTTCCCGCACTCGTCC
CCATCGATTCACACGGCCTCTTCGAGCAGCTCCCTCAGCTCTCTGCATCCTACGACGACGGTGGGGTCGATCATG
ACCAGCGATCGCCCGTCGTTGACCGCTGTGACAACGGAGCGCAAGCCGTCGTTGACCGCTGTGACAACGGAGCGC
AAGCCGTCATCGACCGTTGTGACAACGGAGCGAAAGCCGTCATCGACCGTTGTGACAACGGAGCGAAAGCCGTCA
TCGACCGTAGTCTCCCAGCAGCTGCCGACGTCCTCATCCGCAAGCCAGCCACCATCGGAAGCGCCTCAGCCCGCT
CCCACAAACTTTCCCAAGTACATTGCTCCCAGCAAACCGGCGGCATTGGCTCCTGTCGGCACGAGAAATATCACG
ATAGCACTGAACAACATCGTGATGTACAATGAAATCGATATCATCTCGACATTTAACATCACCTCGAGGCTTCTT
CCATCCCTCCTCTCGCTGAGCCTCGCGCCGAGGAGCGCCGATAAAATTGTCATCTTCAGTCTCGAGCGTTGTGTC
GATTCGGTCCAGCCGTTCAGTGTCCTCGCCCACACAAGTTTCCCGGATGATGACGGCTTTGTGAGACAGCTTCAG
CTGAACCTCGGGCTTGCCAACTCACCCATTTACACGACGGATGCGGCCGAGTTGACCAAGGTTATCGAGAAGAAC
CTCAAAGCCTCTGGCCAATCCATCACACCGACGGATACGCAGGCCGCCCTGAAGCTGAGGGACAATCTGGACAAG
TTCCACAACATCACCGTCGAGCACTGCGTCGCAAGGGGTTCTGAAAAGGGCGCTACAAGCGGTGGCGACCTCGGA
TCGAACGGGGACGTTCAAAATGCCCCGAACCCGGGCAACCAGACGGAGAAGGAAAAGTTGACGACAATGGGCGTC
GCCTTTGGTGTCGTGGGTGCGGGCTTCATGTACGGAGCGGCCATGTTCATCATCGCTCGGCGGTACAAGCGCAAG
AGGCAGACGCACCGTCGCTCCAGCTCCGTCTCCAACAGCCAGGACTCGTCCGAGATGCAGCAAGCCGGCGGCGCC
AGTCCACCTTTGATGGGAGGCGCTCTTCCCAGCCGCGATTACTTTAGTTACGGCGCCGAAGGTCGAGACAGCCGC
GGCAGTGGGCGCAGCGGCATGGCCAACTCGGGCCGCACTGCCAATATTTCGGCGCCCGTTGCTGCCGAGAACTCG
CTTGGCTGGAAC
Transcript >Ophio5|3333
ATGTCAGTCGCGACACAGCTCAACCACATCTTCAGTCGGCTAACGTCCCTTAGATATCGCTCGTTCACATATCGC
GCGTCAAGTACATTCGTTGCATCTATCCTGACACATACGGCAAAGTCCATCGTCCTTTTGCGATACCATTTTGTT
GACGATCCATCAATTTACTTGATATTACCAAAATCGAACGCTGTCATCGTGGCATTGGCCTTGATCGGAATCGTT
GCGGCCGGACCAGACCCCGAACAGCCTCACATCTACTTCCCTCGCAATGAAGTCACGCGCCAAACCTTCAATTCG
ACTTCCTCCACCTCCCACATCCTGACCACGACGGAAAACGGGCTCTCGACCGATCCCGACAGCTCTTCCTCGAGC
CTACACCTACTCGACGAGCTCGTTTCCAGCCTTCTTCGCTCCGCCACCGAAGCAACCTCTAGCGACCGACTCGAT
GACTCGATTGTGACGCCCGTCGGCCCTCCCGCTCTCACAGATGCGCCGAGTGGTACCGGCGGTTTGCCCTACGCC
ACCGTAGCTTCAACGTCCATCAAGTCTATGATTGGGTCGACCCAGAGACCGGAGCCAACCAGACAAGACGGCACC
CAGGAACCATCTTCAGTCAAGCCTAATTTCGGCTCGACGCAGAGGCAGCAACCGTCCAGCCAGGACGACACCCAT
AGATCGTCCTCCGACAAGTCGGAACCGGGGTCAACGTCCAGGCCGGGGCCATCCAGCCAGGATGGCACGCAGAGG
TCTTCATCCGACAAGCTTGAGTCTGGCTCGACACAGAGACCGCAGCCGTCCAGCCAGGTTGACACGCAGAGGCCT
TCATCCGACAAGCTTGAGTCTGGCTCGACGCAGAGGCCACAGCCGTCCAGCCAGGTTGGCACGCAGAGTTCATCC
GACAAGCTTGAGTCTGGCTCGACACAGAGGCCGCAGCCGTCCAGCCAGGTTGGCACGCAGAGTTCATCCGACAAG
CCTGACTTCGGCTCGACGTCCAACGCGGCACCGTCCAGCCAAGGCACTCTCCAGAGACCCTCATCCGATAAGCCT
GAGTTCGGCTCGACGTCCAGGCCGGCATCGTCCAGCCAAGGCACTATCCAGAGATCGTCTTTGGATAAAACCGAG
CCCGGCTCGACGCAGAGACCCGAGTTGTCCAGCCACGACAGCAGCAATAAATCGTCGACGAGGCAGCATGAGGCA
GCGTCGACGTACAAACCGGGACCGTCCAGTTACGCAAGCCCCCAGGCATCGACATCCGGCAAGCCTGAGCCAACT
TCGACCTCAAGATCGGATCCTACCCGCCACAGCCACCTCGATCTGCCGTCCGACGCCGGCATTGTGATTGGCCCC
AACGGCATTGTCACGCCAACTCCCAGCTCAAGCTCCAGGCTCAGAGACGACTCTTCGGATTCGCGTCCGCCGACC
ACCGGCCACAGCGCTGAACCGTCCGTCACTGAAAACGAAACTCAAGCCCAGTCGTCCGCCACCGGCGAGGTCAAG
GCCGCCAAGCCGCCTGTCGTAGGCCTCAGAAAAGGCACCAAGTCGCCTGCCACAGACAAGGGGCCCGAGCTGCCC
GGCGCCGACGGCAGCTTGGCTCCGACTCCGCGGGTCAATGGCTCCTCGCTACAGCCTAATGAGCCGTCGACAACA
TCCTCGAGTACCAAAGATGGCATCCTGGCTCCCGTCGGCAACCTCGCGAGCGGACTGTTACCGGTCCCGACAGCC
AACACTGTTTCTTCTGCGTCTTCGGCCGTCTACAGCAGCGCTCCTACATCTGTCCCGACAACCAAGGCTGGCTTG
TCTGCCCCCAGCGACGTCGATGGCAACCGTCCGATTCCGATCCCGAGCATTAGCGACGTCTTCTCGCGTCCCGGG
GGCACCGCCGTCCGCACCACTTCGGCGTCAGCTTCGTCGACCGAGACAAGTATCCCGAGTTCCGTGATCACTTCC
ATTGAGAACGTGGCACCGACCACCAGCCGGACGGCTCACCTCCCGGACTCTGACGGTGTTGTCTCGTCTCCGACA
TCCCGCTCAGACAGCACTGAGCCCGAGGAGACGTCAACCAACGGTCTTCTTCCGGCTGTGACATCAAAGGCTGCT
GCTCTGACTTCTCTGGTGCCCGCGGTCAACAGTATCCTGCCCCCCCCTGCCAACTCGACTGCGCCTTCGACCCTT
TCGAACCTGACGGTGGGTTCAACGAGCTCCGTTTCGGACCCGACGATACCGCCGCCCATTCCCGTCTTGCCTACC
GGCACGGCACCGACAGCCACCTCCACTTCGAGCGTACCAACCCCTGTGAGCTCTTCTGACAGGGACATTGCTGCA
GACACCTTCATGTCTTCAAACTCGTCCGCAGCGTACACGCCGCCCGAGACGGCCTCTCCAACCAAGTCCGACGGA
CTGCTGCCGCTTGTCACCTCGCTGCTACTGACACAGACGTCCTCGACGGCGCAGACTTCGTCCGATTTGCCACTC
AACACGACGCTTGCCGTGCTGCCCACGGCTACAAGCCAGCCACCCACACTAACCTCTGGCCTCTTCAACGCCACC
ACTGCTAGCACTGTTGCCGAGGTCCCGGTGACAAGTGCGACGAGCACCCAGATCACAAGCAGCTCCCAGACGGCA
GAAACCAGTGGCCCACCCACCATTGCGCCCGTGACGAATGCCACAAGCTCGGTCGAGCCTTCCAGCCAGTCCTTG
AAGCCAACCCTCAATACCACCAGCACGTTGGAGCCGACTGTTTCTTCGACCGGACCAGCCACCACCGAGCTGCTG
TTGACGACTTCTGTCGCGAATACAACCGAGGCGGCATCCAAAACGACGTCGCTGTACCGCTTCCCGCACTCGTCC
CCATCGATTCACACGGCCTCTTCGAGCAGCTCCCTCAGCTCTCTGCATCCTACGACGACGGTGGGGTCGATCATG
ACCAGCGATCGCCCGTCGTTGACCGCTGTGACAACGGAGCGCAAGCCGTCGTTGACCGCTGTGACAACGGAGCGC
AAGCCGTCATCGACCGTTGTGACAACGGAGCGAAAGCCGTCATCGACCGTTGTGACAACGGAGCGAAAGCCGTCA
TCGACCGTAGTCTCCCAGCAGCTGCCGACGTCCTCATCCGCAAGCCAGCCACCATCGGAAGCGCCTCAGCCCGCT
CCCACAAACTTTCCCAAGTACATTGCTCCCAGCAAACCGGCGGCATTGGCTCCTGTCGGCACGAGAAATATCACG
ATAGCACTGAACAACATCGTGATGTACAATGAAATCGATATCATCTCGACATTTAACATCACCTCGAGGCTTCTT
CCATCCCTCCTCTCGCTGAGCCTCGCGCCGAGGAGCGCCGATAAAATTGTCATCTTCAGTCTCGAGCGTTGTGTC
GATTCGGTCCAGCCGTTCAGTGTCCTCGCCCACACAAGTTTCCCGGATGATGACGGCTTTGTGAGACAGCTTCAG
CTGAACCTCGGGCTTGCCAACTCACCCATTTACACGACGGATGCGGCCGAGTTGACCAAGGTTATCGAGAAGAAC
CTCAAAGCCTCTGGCCAATCCATCACACCGACGGATACGCAGGCCGCCCTGAAGCTGAGGGACAATCTGGACAAG
TTCCACAACATCACCGTCGAGCACTGCGTCGCAAGGGGTTCTGAAAAGGGCGCTACAAGCGGTGGCGACCTCGGA
TCGAACGGGGACGTTCAAAATGCCCCGAACCCGGGCAACCAGACGGAGAAGGAAAAGTTGACGACAATGGGCGTC
GCCTTTGGTGTCGTGGGTGCGGGCTTCATGTACGGAGCGGCCATGTTCATCATCGCTCGGCGGTACAAGCGCAAG
AGGCAGACGCACCGTCGCTCCAGCTCCGTCTCCAACAGCCAGGACTCGTCCGAGATGCAGCAAGCCGGCGGCGCC
AGTCCACCTTTGATGGGAGGCGCTCTTCCCAGCCGCGATTACTTTAGTTACGGCGCCGAAGGTCGAGACAGCCGC
GGCAGTGGGCGCAGCGGCATGGCCAACTCGGGCCGCACTGCCAATATTTCGGCGCCCGTTGCTGCCGAGAACTCG
CTTGGCTGGAACTGA
Gene >Ophio5|3333
ATGTCAGTCGCGACACAGCTCAACCACATCTTCAGTCGGCTAACGTCCCTTAGATATCGCTCGTTCACATATCGC
GCGTCAAGTACATTCGTTGCATCTATCCTGACAGTATGCTCTTACTTTATTTCTTTCTTCAATAGCGGCTCGACA
CTGACGACCACCGCAGCATACGGCAAAGTCCATCGTCCTTTTGCGATACCATTTTGTTGACGATCCATCAATTTA
CTTGATATTACCAAAAGTCAGCCTGATATTCAGACTTCTCGTTCCGACGCACACATAAAAAATGCACGCCAAGTC
GAACGCTGTCATCGTGGCATTGGCCTTGATCGGAATCGTTGCGGCCGGACCAGACCCCGAACAGCCTCACATCTA
CTTCCCTCGCAATGAAGTCACGCGCCAAACCTTCAATTCGACTTCCTCCACCTCCCACATCCTGACCACGACGGA
AAACGGGCTCTCGACCGATCCCGACAGCTCTTCCTCGAGCCTACACCTACTCGACGAGCTCGTTTCCAGCCTTCT
TCGCTCCGCCACCGAAGCAACCTCTAGCGACCGACTCGATGACTCGATTGTGACGCCCGTCGGCCCTCCCGCTCT
CACAGATGCGCCGAGTGGTACCGGCGGTTTGCCCTACGCCACCGTAGCTTCAACGTCCATCAAGTCTATGATTGG
GTCGACCCAGAGACCGGAGCCAACCAGACAAGACGGCACCCAGGAACCATCTTCAGTCAAGCCTAATTTCGGCTC
GACGCAGAGGCAGCAACCGTCCAGCCAGGACGACACCCATAGATCGTCCTCCGACAAGTCGGAACCGGGGTCAAC
GTCCAGGCCGGGGCCATCCAGCCAGGATGGCACGCAGAGGTCTTCATCCGACAAGCTTGAGTCTGGCTCGACACA
GAGACCGCAGCCGTCCAGCCAGGTTGACACGCAGAGGCCTTCATCCGACAAGCTTGAGTCTGGCTCGACGCAGAG
GCCACAGCCGTCCAGCCAGGTTGGCACGCAGAGTTCATCCGACAAGCTTGAGTCTGGCTCGACACAGAGGCCGCA
GCCGTCCAGCCAGGTTGACACGCAGAGGTCTTCATCCGACAAGCTTGAGTCTGGCTCGACACAGAGGCCACAGCC
GTCCAGCCAGGTTGGCACGCAGAGTTCATCCGACAAGCCTGACTTCGGCTCGACGTCCAACGCGGCACCGTCCAG
CCAAGGCACTCTCCAGAGACCCTCATCCGATAAGCCTGAGTTCGGCTCGACGTCCAGGCCGGCATCGTCCAGCCA
AGGCACTATCCAGAGATCGTCTTTGGATAAAACCGAGCCCGGCTCGACGCAGAGACCCGAGTTGTCCAGCCACGA
CAGCAGCAATAAATCGTCGACGAGGCAGCATGAGGCAGCGTCGACGTACAAACCGGGACCGTCCAGTTACGCAAG
CCCCCAGGCATCGACATCCGGCAAGCCTGAGCCAACTTCGACCTCAAGATCGGATCCTACCCGCCACAGCCACCT
CGATCTGCCGTCCGACGCCGGCATTGTGATTGGCCCCAACGGCATTGTCACGCCAACTCCCAGCTCAAGCTCCAG
GCTCAGAGACGACTCTTCGGATTCGCGTCCGCCGACCACCGGCCACAGCGCTGAACCGTCCGTCACTGAAAACGA
AACTCAAGCCCAGTCGTCCGCCACCGGCGAGGTCAAGGCCGCCAAGCCGCCTGTCGTAGGCCTCAGAAAAGGCAC
CAAGTCGCCTGCCACAGACAAGGGGCCCGAGCTGCCCGGCGCCGACGGCAGCTTGGCTCCGACTCCGCGGGTCAA
TGGCTCCTCGCTACAGCCTAATGAGCCGTCGACAACATCCTCGAGTACCAAAGATGGCATCCTGGCTCCCGTCGG
CAACCTCGCGAGCGGACTGTTACCGGTCCCGACAGCCAACACTGTTTCTTCTGCGTCTTCGGCCGTCTACAGCAG
CGCTCCTACATCTGTCCCGACAACCAAGGCTGGCTTGTCTGCCCCCAGCGACGTCGATGGCAACCGTCCGATTCC
GATCCCGAGCATTAGCGACGTCTTCTCGCGTCCCGGGGGCACCGCCGTCCGCACCACTTCGGCGTCAGCTTCGTC
GACCGAGACAAGTATCCCGAGTTCCGTGATCACTTCCATTGAGAACGTGGCACCGACCACCAGCCGGACGGCTCA
CCTCCCGGACTCTGACGGTGTTGTCTCGTCTCCGACATCCCGCTCAGACAGCACTGAGCCCGAGGAGACGTCAAC
CAACGGTCTTCTTCCGGCTGTGACATCAAAGGCTGCTGCTCTGACTTCTCTGGTGCCCGCGGTCAACAGTATCCT
GCCCCCCCCTGCCAACTCGACTGCGCCTTCGACCCTTTCGAACCTGACGGTGGGTTCAACGAGCTCCGTTTCGGA
CCCGACGATACCGCCGCCCATTCCCGTCTTGCCTACCGGCACGGCACCGACAGCCACCTCCACTTCGAGCGTACC
AACCCCTGTGAGCTCTTCTGACAGGGACATTGCTGCAGACACCTTCATGTCTTCAAACTCGTCCGCAGCGTACAC
GCCGCCCGAGACGGCCTCTCCAACCAAGTCCGACGGACTGCTGCCGCTTGTCACCTCGCTGCTACTGACACAGAC
GTCCTCGACGGCGCAGACTTCGTCCGATTTGCCACTCAACACGACGCTTGCCGTGCTGCCCACGGCTACAAGCCA
GCCACCCACACTAACCTCTGGCCTCTTCAACGCCACCACTGCTAGCACTGTTGCCGAGGTCCCGGTGACAAGTGC
GACGAGCACCCAGATCACAAGCAGCTCCCAGACGGCAGAAACCAGTGGCCCACCCACCATTGCGCCCGTGACGAA
TGCCACAAGCTCGGTCGAGCCTTCCAGCCAGTCCTTGAAGCCAACCCTCAATACCACCAGCACGTTGGAGCCGAC
TGTTTCTTCGACCGGACCAGCCACCACCGAGCTGCTGTTGACGACTTCTGTCGCGAATACAACCGAGGCGGCATC
CAAAACGACGTCGCTGTACCGCTTCCCGCACTCGTCCCCATCGATTCACACGGCCTCTTCGAGCAGCTCCCTCAG
CTCTCTGCATCCTACGACGACGGTGGGGTCGATCATGACCAGCGATCGCCCGTCGTTGACCGCTGTGACAACGGA
GCGCAAGCCGTCGTTGACCGCTGTGACAACGGAGCGCAAGCCGTCATCGACCGTTGTGACAACGGAGCGAAAGCC
GTCATCGACCGTTGTGACAACGGAGCGAAAGCCGTCATCGACCGTAGTCTCCCAGCAGCTGCCGACGTCCTCATC
CGCAAGCCAGCCACCATCGGAAGCGCCTCAGCCCGCTCCCACAAACTTTCCCAAGTACATTGCTCCCAGCAAACC
GGCGGCATTGGCTCCTGTCGGCACGAGAAATATCACGATAGCACTGAACAACATCGTGATGTACAATGAAATCGA
TATCATCTCGACATTTAACATCACCTCGAGGCTTCTTCCATCCCTCCTCTCGCTGAGCCTCGCGCCGAGGAGCGC
CGATAAAATTGTCATCTTCAGTCTCGAGCGTTGTGTCGATTCGGTCCAGCCGTTCAGTGTCCTCGCCCACACAAG
TTTCCCGGATGATGACGGCTTTGTGAGACAGCTTCAGCTGAACCTCGGGCTTGCCAACTCACCCATTTACACGAC
GGATGCGGCCGAGTTGACCAAGGTTATCGAGAAGAACCTCAAAGCCTCTGGCCAATCCATCACACCGACGGATAC
GCAGGCCGCCCTGAAGCTGAGGGACAATCTGGACAAGTTCCACAACATCACCGTCGAGCACTGCGTCGCAAGGGG
TTCTGAAAAGGGCGCTACAAGCGGTGGCGACCTCGGATCGAACGGGGACGTTCAAAATGCCCCGAACCCGGGCAA
CCAGACGGAGAAGGAAAAGTTGACGACAATGGGCGTCGCCTTTGGTGTCGTGGGTGCGGGCTTCATGTACGGAGC
GGCCATGTTCATCATCGCTCGGCGGTACAAGCGCAAGAGGCAGACGCACCGTCGCTCCAGCTCCGTCTCCAACAG
CCAGGACTCGTCCGAGATGCAGCAAGCCGGCGGCGCCAGTCCACCTTTGATGGGAGGCGCTCTTCCCAGCCGCGA
TTACTTTAGTTACGGCGCCGAAGGTCGAGACAGCCGCGGCAGTGGGCGCAGCGGCATGGCCAACTCGGGCCGCAC
TGCCAATATTTCGGCGCCCGTTGCTGCCGAGAACTCGCTTGGCTGGAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail