Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3329
Gene name
Locationscaffold_263:23708..25420
Strand+
Gene length (bp)1712
Transcript length (bp)1518
Coding sequence length (bp)1515
Protein length (aa) 505

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05602 CLPTM1 Cleft lip and palate transmembrane protein 1 (CLPTM1) 2.1E-140 36 495

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2NL17|CLPT1_BOVIN Cleft lip and palate transmembrane protein 1 homolog OS=Bos taurus GN=CLPTM1 PE=2 SV=1 103 495 3.0E-44
sp|O96005|CLPT1_HUMAN Cleft lip and palate transmembrane protein 1 OS=Homo sapiens GN=CLPTM1 PE=1 SV=1 157 495 4.0E-44
sp|Q6DEL2|CLPT1_DANRE Cleft lip and palate transmembrane protein 1 homolog OS=Danio rerio GN=clptm1 PE=2 SV=1 103 495 4.0E-43
sp|Q8VBZ3|CLPT1_MOUSE Cleft lip and palate transmembrane protein 1 homolog OS=Mus musculus GN=Clptm1 PE=1 SV=1 157 495 3.0E-42
sp|Q54RJ1|CNRB_DICDI CLPTM1-like membrane protein cnrB OS=Dictyostelium discoideum GN=cnrB PE=3 SV=1 95 495 9.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2NL17|CLPT1_BOVIN Cleft lip and palate transmembrane protein 1 homolog OS=Bos taurus GN=CLPTM1 PE=2 SV=1 103 495 3.0E-44
sp|O96005|CLPT1_HUMAN Cleft lip and palate transmembrane protein 1 OS=Homo sapiens GN=CLPTM1 PE=1 SV=1 157 495 4.0E-44
sp|Q6DEL2|CLPT1_DANRE Cleft lip and palate transmembrane protein 1 homolog OS=Danio rerio GN=clptm1 PE=2 SV=1 103 495 4.0E-43
sp|Q8VBZ3|CLPT1_MOUSE Cleft lip and palate transmembrane protein 1 homolog OS=Mus musculus GN=Clptm1 PE=1 SV=1 157 495 3.0E-42
sp|Q54RJ1|CNRB_DICDI CLPTM1-like membrane protein cnrB OS=Dictyostelium discoideum GN=cnrB PE=3 SV=1 95 495 9.0E-40
sp|Q5R7B1|CLP1L_PONAB Cleft lip and palate transmembrane protein 1-like protein OS=Pongo abelii GN=CLPTM1L PE=2 SV=1 133 495 2.0E-31
sp|Q96KA5|CLP1L_HUMAN Cleft lip and palate transmembrane protein 1-like protein OS=Homo sapiens GN=CLPTM1L PE=1 SV=1 133 495 2.0E-31
sp|Q8BXA5|CLP1L_MOUSE Cleft lip and palate transmembrane protein 1-like protein OS=Mus musculus GN=Clptm1l PE=1 SV=1 133 495 2.0E-29
sp|Q5ZKJ0|CLP1L_CHICK Cleft lip and palate transmembrane protein 1-like protein OS=Gallus gallus GN=CLPTM1L PE=2 SV=1 133 495 4.0E-29
sp|A2VE61|CLP1L_BOVIN Cleft lip and palate transmembrane protein 1-like protein OS=Bos taurus GN=CLPTM1L PE=2 SV=1 133 495 3.0E-26
sp|Q6DHU1|CLP1L_DANRE Cleft lip and palate transmembrane protein 1-like protein OS=Danio rerio GN=clptm1l PE=2 SV=1 133 495 4.0E-26
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 27 49 22
2 367 389 22
3 402 424 22
4 429 446 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 84.07 45.67 122.48
CcL In ants, during behavior modification 86.78 46.35 127.21
CcD In ants, recently dead 71.39 38.76 104.02

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.913258 no
SC16a CcD 0.522791 no
CcL CcD 0.436786 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3329
MASSVGQKQMEPQPVPPQQEQQRRGGFNLNRLVLGIAIYLGFNLLLPFVMRKDQRSETVTDPETGRSVVVASNME
GIPPFQLRPKTLDEGKQYRSIPRKIAPIWPQDSMVDIVVTLSPSFNPTPIAQTPAEYVVLREKSFHMDNKSDVRS
IDTTFTVPKAVQNNGTLWGHFYIGLADSQLDPREPGFDSDKAYHFAHPLTQYLAKKKVAKTRNLLDARTEEEPGE
PEPTGPVVTSHYHANASFAFVPAMGVKDFSQLHPAIRQFLRLEATGARDGSGENGWYYPLLFVNTFWQLTNHMTV
LNDTVKELPLHIDVKNMAFWQFQMLASIEMNSKENARQAAFGASLPGGGDGTEIEMVKEIFIDTNPILLAITAVV
TVAHLLLETLAFGSDIAHYRKKKDNVGISVRSILANVVMQAIIFLYLLDNSQNTSWMILGTQGVGILIELWKMTT
VVNVRLRPAAPGSLVPWRLVMEDKHKLTETEAKTKEYDEVAFRYIRGTRSSSRRW
Coding >Ophio5|3329
ATGGCGTCTTCAGTCGGCCAAAAGCAAATGGAGCCGCAGCCGGTTCCTCCTCAGCAGGAGCAGCAGCGGAGAGGT
GGCTTCAACCTCAACCGACTGGTGCTCGGCATCGCCATCTACCTCGGCTTCAACCTCTTACTGCCGTTCGTTATG
CGCAAGGATCAGCGCTCCGAGACCGTGACAGATCCGGAGACGGGCCGTTCCGTTGTCGTGGCGAGCAACATGGAG
GGCATTCCACCCTTTCAGTTGCGGCCCAAGACTCTCGACGAGGGCAAGCAGTATCGGTCGATTCCGCGCAAGATT
GCGCCCATCTGGCCGCAGGATAGCATGGTTGATATCGTCGTGACACTTTCGCCGTCATTCAATCCGACGCCCATC
GCGCAGACGCCGGCCGAGTACGTCGTGCTGCGGGAGAAGAGCTTCCACATGGATAACAAGTCGGACGTGCGCTCC
ATTGATACCACATTTACTGTACCCAAAGCCGTACAGAACAACGGGACGCTCTGGGGACACTTTTACATCGGCCTT
GCCGATAGCCAGCTCGACCCCCGCGAGCCTGGCTTCGACTCGGACAAGGCCTATCATTTTGCCCATCCCCTGACC
CAGTACCTTGCCAAGAAGAAGGTGGCCAAGACGCGCAATCTGCTGGACGCCCGGACGGAGGAGGAGCCGGGGGAG
CCGGAGCCGACTGGGCCAGTCGTTACCAGCCACTACCATGCCAATGCCAGCTTCGCCTTTGTCCCGGCCATGGGC
GTCAAGGATTTTTCACAGCTGCATCCGGCTATCCGCCAGTTTTTGCGGCTGGAGGCGACGGGCGCCCGGGACGGG
AGTGGTGAAAATGGATGGTACTACCCGCTCCTGTTCGTCAACACGTTTTGGCAACTCACCAATCACATGACGGTT
CTCAACGACACGGTCAAAGAGCTCCCGCTGCATATCGACGTCAAGAACATGGCCTTTTGGCAGTTCCAGATGCTG
GCGTCCATCGAGATGAACTCCAAGGAGAACGCGCGACAGGCTGCCTTTGGCGCCTCGTTGCCCGGCGGCGGAGAC
GGCACCGAGATCGAAATGGTCAAGGAAATCTTTATCGACACGAATCCGATCCTGCTGGCCATCACGGCAGTGGTG
ACGGTGGCGCACCTGCTCCTGGAGACGCTGGCCTTTGGGTCCGACATCGCTCATTACCGCAAGAAGAAGGATAAT
GTCGGCATCTCGGTGCGGTCGATCCTGGCCAACGTGGTGATGCAGGCCATCATCTTTCTCTACCTGCTCGACAAC
TCGCAGAACACTAGCTGGATGATTCTCGGCACGCAGGGCGTCGGCATCCTCATCGAGCTGTGGAAGATGACGACG
GTGGTCAACGTGCGCTTGCGGCCGGCCGCTCCCGGCTCACTCGTCCCTTGGCGGTTGGTCATGGAAGACAAGCAC
AAGCTGACAGAGACGGAGGCCAAGACTAAAGAGTACGACGAGGTCGCGTTCCGGTACATTCGTGGTACTCGTTCG
TCATCACGACGCTGG
Transcript >Ophio5|3329
ATGGCGTCTTCAGTCGGCCAAAAGCAAATGGAGCCGCAGCCGGTTCCTCCTCAGCAGGAGCAGCAGCGGAGAGGT
GGCTTCAACCTCAACCGACTGGTGCTCGGCATCGCCATCTACCTCGGCTTCAACCTCTTACTGCCGTTCGTTATG
CGCAAGGATCAGCGCTCCGAGACCGTGACAGATCCGGAGACGGGCCGTTCCGTTGTCGTGGCGAGCAACATGGAG
GGCATTCCACCCTTTCAGTTGCGGCCCAAGACTCTCGACGAGGGCAAGCAGTATCGGTCGATTCCGCGCAAGATT
GCGCCCATCTGGCCGCAGGATAGCATGGTTGATATCGTCGTGACACTTTCGCCGTCATTCAATCCGACGCCCATC
GCGCAGACGCCGGCCGAGTACGTCGTGCTGCGGGAGAAGAGCTTCCACATGGATAACAAGTCGGACGTGCGCTCC
ATTGATACCACATTTACTGTACCCAAAGCCGTACAGAACAACGGGACGCTCTGGGGACACTTTTACATCGGCCTT
GCCGATAGCCAGCTCGACCCCCGCGAGCCTGGCTTCGACTCGGACAAGGCCTATCATTTTGCCCATCCCCTGACC
CAGTACCTTGCCAAGAAGAAGGTGGCCAAGACGCGCAATCTGCTGGACGCCCGGACGGAGGAGGAGCCGGGGGAG
CCGGAGCCGACTGGGCCAGTCGTTACCAGCCACTACCATGCCAATGCCAGCTTCGCCTTTGTCCCGGCCATGGGC
GTCAAGGATTTTTCACAGCTGCATCCGGCTATCCGCCAGTTTTTGCGGCTGGAGGCGACGGGCGCCCGGGACGGG
AGTGGTGAAAATGGATGGTACTACCCGCTCCTGTTCGTCAACACGTTTTGGCAACTCACCAATCACATGACGGTT
CTCAACGACACGGTCAAAGAGCTCCCGCTGCATATCGACGTCAAGAACATGGCCTTTTGGCAGTTCCAGATGCTG
GCGTCCATCGAGATGAACTCCAAGGAGAACGCGCGACAGGCTGCCTTTGGCGCCTCGTTGCCCGGCGGCGGAGAC
GGCACCGAGATCGAAATGGTCAAGGAAATCTTTATCGACACGAATCCGATCCTGCTGGCCATCACGGCAGTGGTG
ACGGTGGCGCACCTGCTCCTGGAGACGCTGGCCTTTGGGTCCGACATCGCTCATTACCGCAAGAAGAAGGATAAT
GTCGGCATCTCGGTGCGGTCGATCCTGGCCAACGTGGTGATGCAGGCCATCATCTTTCTCTACCTGCTCGACAAC
TCGCAGAACACTAGCTGGATGATTCTCGGCACGCAGGGCGTCGGCATCCTCATCGAGCTGTGGAAGATGACGACG
GTGGTCAACGTGCGCTTGCGGCCGGCCGCTCCCGGCTCACTCGTCCCTTGGCGGTTGGTCATGGAAGACAAGCAC
AAGCTGACAGAGACGGAGGCCAAGACTAAAGAGTACGACGAGGTCGCGTTCCGGTACATTCGTGGTACTCGTTCG
TCATCACGACGCTGGTAG
Gene >Ophio5|3329
ATGGCGTCTTCAGTCGGCCAAAAGCAAATGGAGCCGCAGCCGGTTCCTCCTCAGCAGGAGCAGCAGCGGAGAGGT
GTGAGTGTTTCAAAACCTCTATTGAGCGTCCCCCCCTCTTCATATCTCTAATGGGTCGGTCGTTCAGGGCTTCAA
CCTCAACCGACTGGTGCTCGGCATCGCCATCTACCTCGGCTTCAACCTCTTACTGCCGTTCGTTATGCGCAAGGA
TCAGCGCTCCGAGACCGTGACAGATCCGGAGACGGGCCGTTCCGTTGTCGTGGCGAGCAACATGGAGGGCATTCC
ACCCTTTCAGTTGCGGCCCAAGACTCTCGACGAGGGCAAGCAGTATCGGTCGATTCCGCGCAAGATTGCGCCCAT
CTGGCCGCAGGATAGCATGGTTGATATCGTCGTGACACTTTCGCCGTCATTCAATCCGACGCCCATCGCGCAGAC
GCCGGCCGAGTACGTCGTGCTGCGGGAGAAGAGCTTCCACATGGATAACAAGTCGGACGTGCGCTCCATTGATAC
CACATTTACTGTACCCAAAGCCGTACAGAACAACGGGACGCTCTGGGGACACTTTTACATCGGCCTTGCCGATAG
CCAGCTCGACCCCCGCGAGCCTGGCTTCGACTCGGACAAGGCCTATCATTTTGCCCATCCCCTGACCCAGTACCT
TGCCAAGAAGAAGGTGGCCAAGACGCGCAATCTGCTGGACGCCCGGACGGAGGAGGAGCCGGGGGAGCCGGAGCC
GACTGGGCCAGTCGTTACCAGCCACTACCATGCCAATGCCAGCTTCGCCTTTGTCCCGGCCATGGGCGTCAAGGA
TTTTTCACAGCTGCATCCGGCTATCCGCCAGTTTTTGCGGCTGGAGGCGACGGGCGCCCGGGACGGGAGTGGTGA
AAATGGATGGTACTGTACGTTGCTAAAAACCCCGGTTCTCGTCTTTGCCTCGCTGACCTTGGCGGCTGCCTTAGA
CCCGCTCCTGTTCGTCAACACGTTTTGGCAACTCACCAATCACATGACGGTTCTCAACGACACGGTCAAAGAGCT
CCCGCTGCATATCGACGTCAAGAACATGGCCTTTTGGCAGTTCCAGATGCTGGCGTCCATCGAGATGAACTCCAA
GGAGAACGCGCGACAGGCTGCCTTTGGCGCCTCGTTGCCCGGCGGCGGAGACGGCACCGAGATCGAAATGGTCAA
GGAAATCTTTATCGACACGAATCCGATCCTGCTGGCCATCACGGCAGTGGTGACGGTGGCGCACCTGCTCCTGGA
GACGCTGGCCTTTGGGTCCGACATCGCTCATTACCGCAAGAAGAAGGATAATGTCGGCATCTCGGTGCGGTCGAT
CCTGGCCAACGTGGTGATGCAGGCCATCATCTTTCTCTACCTGCTCGACAACTCGCAGAACACTAGCTGGATGAT
TCTCGGCACGCAGGGCGTCGGCATCCTCATCGAGCTGTGGAAGATGACGACGGTGGTCAACGTGCGCTTGCGGCC
GGCCGCTCCCGGCTCACTCGTCCCTTGGCGGTTGGTCATGGAAGACAAGCACAAGCTGACAGAGACGGAGGCCAA
GACTAAAGAGTACGACGAGGTCGCGTTCCGGTACATGTACGTGGTGGCGGTGCCGTTACTGGTTGCGTACGGCGT
GTACTCACTCGTGTACGAGACGCATAAGTCGTGGTACTCGTTCGTCATCACGACGCTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail