Protein ID | Ophio5|3326 |
Gene name | |
Location | scaffold_263:16764..17688 |
Strand | + |
Gene length (bp) | 924 |
Transcript length (bp) | 813 |
Coding sequence length (bp) | 810 |
Protein length (aa) | 270 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00227 | Proteasome | Proteasome subunit | 3.4E-51 | 29 | 215 |
PF10584 | Proteasome_A_N | Proteasome subunit A N-terminal signature | 7.0E-11 | 6 | 28 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O14250|PSA6_SCHPO | Probable proteasome subunit alpha type-6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.04c PE=3 SV=1 | 1 | 244 | 3.0E-102 |
sp|Q9R1P4|PSA1_MOUSE | Proteasome subunit alpha type-1 OS=Mus musculus GN=Psma1 PE=1 SV=1 | 1 | 262 | 5.0E-95 |
sp|Q3T0X5|PSA1_BOVIN | Proteasome subunit alpha type-1 OS=Bos taurus GN=PSMA1 PE=1 SV=1 | 1 | 248 | 5.0E-95 |
sp|P25786|PSA1_HUMAN | Proteasome subunit alpha type-1 OS=Homo sapiens GN=PSMA1 PE=1 SV=1 | 1 | 248 | 6.0E-95 |
sp|P18420|PSA1_RAT | Proteasome subunit alpha type-1 OS=Rattus norvegicus GN=Psma1 PE=1 SV=2 | 1 | 248 | 2.0E-94 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O14250|PSA6_SCHPO | Probable proteasome subunit alpha type-6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.04c PE=3 SV=1 | 1 | 244 | 3.0E-102 |
sp|Q9R1P4|PSA1_MOUSE | Proteasome subunit alpha type-1 OS=Mus musculus GN=Psma1 PE=1 SV=1 | 1 | 262 | 5.0E-95 |
sp|Q3T0X5|PSA1_BOVIN | Proteasome subunit alpha type-1 OS=Bos taurus GN=PSMA1 PE=1 SV=1 | 1 | 248 | 5.0E-95 |
sp|P25786|PSA1_HUMAN | Proteasome subunit alpha type-1 OS=Homo sapiens GN=PSMA1 PE=1 SV=1 | 1 | 248 | 6.0E-95 |
sp|P18420|PSA1_RAT | Proteasome subunit alpha type-1 OS=Rattus norvegicus GN=Psma1 PE=1 SV=2 | 1 | 248 | 2.0E-94 |
sp|Q4R3H2|PSA1_MACFA | Proteasome subunit alpha type-1 OS=Macaca fascicularis GN=PSMA1 PE=2 SV=1 | 1 | 248 | 3.0E-94 |
sp|Q5REN2|PSA1_PONAB | Proteasome subunit alpha type-1 OS=Pongo abelii GN=PSMA1 PE=2 SV=1 | 1 | 248 | 3.0E-94 |
sp|P40302|PSA6_YEAST | Proteasome subunit alpha type-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE5 PE=1 SV=1 | 1 | 240 | 1.0E-90 |
sp|O42265|PSA1_CHICK | Proteasome subunit alpha type-1 OS=Gallus gallus GN=PSMA1 PE=2 SV=2 | 8 | 267 | 1.0E-88 |
sp|Q27562|PSA1_DICDI | Proteasome subunit alpha type-1 OS=Dictyostelium discoideum GN=psmA1 PE=3 SV=1 | 1 | 246 | 2.0E-81 |
sp|O44156|PSA1_CAEEL | Proteasome subunit alpha type-1 OS=Caenorhabditis elegans GN=pas-6 PE=1 SV=1 | 1 | 232 | 7.0E-78 |
sp|P34066|PSA1A_ARATH | Proteasome subunit alpha type-1-A OS=Arabidopsis thaliana GN=PAF1 PE=1 SV=3 | 1 | 243 | 3.0E-77 |
sp|O23712|PSA1B_ARATH | Proteasome subunit alpha type-1-B OS=Arabidopsis thaliana GN=PAF2 PE=1 SV=2 | 1 | 243 | 1.0E-76 |
sp|P52428|PSA1_ORYSJ | Proteasome subunit alpha type-1 OS=Oryza sativa subsp. japonica GN=PAF1 PE=2 SV=1 | 1 | 243 | 9.0E-76 |
sp|P12881|PSA1_DROME | Proteasome subunit alpha type-1 OS=Drosophila melanogaster GN=Prosalpha6 PE=1 SV=1 | 1 | 235 | 5.0E-72 |
sp|P92188|PSA1_TRYCR | Proteasome subunit alpha type-1 OS=Trypanosoma cruzi PE=2 SV=1 | 1 | 238 | 4.0E-69 |
sp|O96788|PSA1_TRYBR | Proteasome subunit alpha type-1 OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 1 | 216 | 4.0E-68 |
sp|Q9UXC6|PSA_SULSO | Proteasome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmA PE=3 SV=1 | 6 | 219 | 2.0E-40 |
sp|C3NEC6|PSA_SULIY | Proteasome subunit alpha OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmA PE=3 SV=1 | 6 | 219 | 3.0E-40 |
sp|C3NHC6|PSA_SULIN | Proteasome subunit alpha OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmA PE=3 SV=1 | 6 | 219 | 3.0E-40 |
sp|C3MVG1|PSA_SULIM | Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmA PE=3 SV=1 | 6 | 219 | 3.0E-40 |
sp|C3MQ43|PSA_SULIL | Proteasome subunit alpha OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmA PE=3 SV=1 | 6 | 219 | 3.0E-40 |
sp|C4KHD9|PSA_SULIK | Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmA PE=3 SV=1 | 6 | 219 | 3.0E-40 |
sp|C3N5R0|PSA_SULIA | Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.16.27) GN=psmA PE=3 SV=1 | 6 | 219 | 3.0E-40 |
sp|O29760|PSA_ARCFU | Proteasome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmA PE=1 SV=1 | 6 | 241 | 2.0E-37 |
sp|Q9UT97|PSA5_SCHPO | Probable proteasome subunit alpha type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup2 PE=1 SV=1 | 1 | 236 | 2.0E-37 |
sp|P25156|PSA_THEAC | Proteasome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmA PE=1 SV=2 | 6 | 240 | 3.0E-37 |
sp|C6A459|PSA_THESM | Proteasome subunit alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmA PE=3 SV=1 | 6 | 227 | 3.0E-37 |
sp|Q8ZVM1|PSA_PYRAE | Proteasome subunit alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmA PE=3 SV=1 | 6 | 199 | 4.0E-37 |
sp|O59219|PSA_PYRHO | Proteasome subunit alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmA PE=3 SV=1 | 6 | 218 | 5.0E-37 |
sp|Q18K08|PSA_HALWD | Proteasome subunit alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmA PE=3 SV=1 | 6 | 220 | 5.0E-37 |
sp|Q4JB24|PSA_SULAC | Proteasome subunit alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmA PE=3 SV=1 | 6 | 219 | 5.0E-37 |
sp|Q975G5|PSA_SULTO | Proteasome subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmA PE=3 SV=2 | 6 | 219 | 1.0E-36 |
sp|Q9V122|PSA_PYRAB | Proteasome subunit alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmA PE=3 SV=1 | 6 | 218 | 2.0E-36 |
sp|Q8TYB7|PSA_METKA | Proteasome subunit alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmA PE=3 SV=1 | 3 | 215 | 2.0E-36 |
sp|P57697|PSA_HALSA | Proteasome subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=psmA PE=3 SV=1 | 6 | 219 | 3.0E-36 |
sp|B0R2T2|PSA_HALS3 | Proteasome subunit alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=psmA PE=3 SV=1 | 6 | 219 | 3.0E-36 |
sp|C5A2C2|PSA_THEGJ | Proteasome subunit alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmA PE=3 SV=1 | 6 | 199 | 3.0E-36 |
sp|Q9U793|PSA2_TRYBB | Proteasome subunit alpha type-2 OS=Trypanosoma brucei brucei PE=2 SV=1 | 11 | 215 | 4.0E-36 |
sp|Q5JIU9|PSA_THEKO | Proteasome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmA PE=3 SV=1 | 6 | 199 | 4.0E-36 |
sp|O24733|PSA_THEK1 | Proteasome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=psmA PE=3 SV=1 | 6 | 199 | 5.0E-36 |
sp|Q97BZ8|PSA_THEVO | Proteasome subunit alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmA PE=3 SV=2 | 6 | 240 | 5.0E-36 |
sp|Q4R7D9|PSA7L_MACFA | Proteasome subunit alpha type-7-like OS=Macaca fascicularis GN=PSMA7L PE=2 SV=1 | 4 | 240 | 5.0E-36 |
sp|A7I9C7|PSA_METB6 | Proteasome subunit alpha OS=Methanoregula boonei (strain 6A8) GN=psmA PE=3 SV=1 | 2 | 215 | 6.0E-36 |
sp|B6YSH9|PSA_THEON | Proteasome subunit alpha OS=Thermococcus onnurineus (strain NA1) GN=psmA PE=3 SV=1 | 6 | 199 | 6.0E-36 |
sp|A4YCU9|PSA_METS5 | Proteasome subunit alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmA PE=3 SV=1 | 6 | 213 | 8.0E-36 |
sp|Q9PTW9|PSA7_CARAU | Proteasome subunit alpha type-7 OS=Carassius auratus GN=psma7 PE=2 SV=1 | 6 | 197 | 8.0E-36 |
sp|Q59565|PSA_METTE | Proteasome subunit alpha OS=Methanosarcina thermophila GN=psmA PE=3 SV=1 | 6 | 227 | 1.0E-35 |
sp|Q5V2X8|PSA1_HALMA | Proteasome subunit alpha 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmA1 PE=3 SV=1 | 6 | 220 | 2.0E-35 |
sp|Q9V2V6|PSA1_HALVD | Proteasome subunit alpha 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmA1 PE=1 SV=2 | 6 | 242 | 2.0E-35 |
sp|Q8U0L6|PSA_PYRFU | Proteasome subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmA PE=3 SV=1 | 6 | 218 | 2.0E-35 |
sp|Q9CWH6|PSA7L_MOUSE | Proteasome subunit alpha type-7-like OS=Mus musculus GN=Psma8 PE=1 SV=1 | 4 | 197 | 5.0E-35 |
sp|P52427|PSA4_SPIOL | Proteasome subunit alpha type-4 OS=Spinacia oleracea GN=PAC1 PE=2 SV=1 | 6 | 212 | 7.0E-35 |
sp|Q94561|PSA5_ENTHI | Proteasome subunit alpha type-5 OS=Entamoeba histolytica PE=3 SV=2 | 1 | 218 | 9.0E-35 |
sp|Q8TPX5|PSA_METAC | Proteasome subunit alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmA PE=3 SV=1 | 6 | 249 | 1.0E-34 |
sp|Q55G04|PSA5_DICDI | Proteasome subunit alpha type-5 OS=Dictyostelium discoideum GN=psmA5 PE=3 SV=1 | 1 | 243 | 1.0E-34 |
sp|Q6L0W3|PSA_PICTO | Proteasome subunit alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmA PE=3 SV=1 | 6 | 205 | 2.0E-34 |
sp|Q9NDA2|PSA7_TRYBB | Proteasome subunit alpha type-7 OS=Trypanosoma brucei brucei GN=PSA4 PE=2 SV=1 | 5 | 199 | 4.0E-34 |
sp|Q60177|PSA_METJA | Proteasome subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmA PE=1 SV=1 | 4 | 218 | 4.0E-34 |
sp|Q9LSU1|PSA5_ORYSJ | Proteasome subunit alpha type-5 OS=Oryza sativa subsp. japonica GN=PAE1 PE=2 SV=1 | 1 | 243 | 5.0E-34 |
sp|Q8PTU1|PSA_METMA | Proteasome subunit alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmA PE=3 SV=1 | 6 | 227 | 1.0E-33 |
sp|O81149|PSA5A_ARATH | Proteasome subunit alpha type-5-A OS=Arabidopsis thaliana GN=PAE1 PE=1 SV=1 | 1 | 216 | 1.0E-33 |
sp|A6VIP0|PSA_METM7 | Proteasome subunit alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmA PE=3 SV=1 | 6 | 264 | 1.0E-33 |
sp|Q9M4T8|PSA5_SOYBN | Proteasome subunit alpha type-5 OS=Glycine max GN=PAE1 PE=2 SV=1 | 1 | 216 | 1.0E-33 |
sp|O81148|PSA4A_ARATH | Proteasome subunit alpha type-4-A OS=Arabidopsis thaliana GN=PAC1 PE=1 SV=1 | 6 | 199 | 2.0E-33 |
sp|A4FZT6|PSA_METM5 | Proteasome subunit alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmA PE=3 SV=1 | 6 | 264 | 2.0E-33 |
sp|Q469M6|PSA_METBF | Proteasome subunit alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmA PE=3 SV=1 | 6 | 163 | 2.0E-33 |
sp|Q42134|PSA5B_ARATH | Proteasome subunit alpha type-5-B OS=Arabidopsis thaliana GN=PAE2 PE=1 SV=2 | 1 | 216 | 2.0E-33 |
sp|O82530|PSA4_PETHY | Proteasome subunit alpha type-4 OS=Petunia hybrida GN=PAC1 PE=2 SV=1 | 6 | 212 | 3.0E-33 |
sp|Q3IPJ1|PSA_NATPD | Proteasome subunit alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=psmA PE=3 SV=1 | 6 | 220 | 7.0E-33 |
sp|Q9XZG5|PSA5_TRYBB | Proteasome subunit alpha type-5 OS=Trypanosoma brucei brucei PE=3 SV=1 | 1 | 246 | 9.0E-33 |
sp|P34119|PSA4_DICDI | Proteasome subunit alpha type-4 OS=Dictyostelium discoideum GN=psmA4 PE=2 SV=1 | 6 | 199 | 2.0E-32 |
sp|Q6M0L9|PSA_METMP | Proteasome subunit alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=psmA PE=3 SV=1 | 4 | 199 | 2.0E-32 |
sp|A3CW55|PSA_METMJ | Proteasome subunit alpha OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=psmA PE=3 SV=1 | 2 | 240 | 2.0E-32 |
sp|Q9Z2U0|PSA7_MOUSE | Proteasome subunit alpha type-7 OS=Mus musculus GN=Psma7 PE=1 SV=1 | 5 | 197 | 3.0E-32 |
sp|Q3ZBG0|PSA7_BOVIN | Proteasome subunit alpha type-7 OS=Bos taurus GN=PSMA7 PE=1 SV=1 | 5 | 197 | 3.0E-32 |
sp|Q8TAA3|PSA7L_HUMAN | Proteasome subunit alpha type-7-like OS=Homo sapiens GN=PSMA8 PE=2 SV=3 | 4 | 240 | 3.0E-32 |
sp|A6URN9|PSA_METVS | Proteasome subunit alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmA PE=3 SV=1 | 6 | 232 | 3.0E-32 |
sp|O24616|PSA7B_ARATH | Proteasome subunit alpha type-7-B OS=Arabidopsis thaliana GN=PAD2 PE=1 SV=2 | 6 | 197 | 5.0E-32 |
sp|Q9SXU1|PSA7_CICAR | Proteasome subunit alpha type-7 OS=Cicer arietinum GN=PAD1 PE=2 SV=1 | 6 | 197 | 5.0E-32 |
sp|Q5RDH8|PSA7_PONAB | Proteasome subunit alpha type-7 OS=Pongo abelii GN=PSMA7 PE=2 SV=2 | 5 | 197 | 6.0E-32 |
sp|O14818|PSA7_HUMAN | Proteasome subunit alpha type-7 OS=Homo sapiens GN=PSMA7 PE=1 SV=1 | 5 | 197 | 7.0E-32 |
sp|A9A846|PSA_METM6 | Proteasome subunit alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmA PE=3 SV=1 | 6 | 177 | 8.0E-32 |
sp|Q6YT00|PSA7A_ORYSJ | Proteasome subunit alpha type-7-A OS=Oryza sativa subsp. japonica GN=Os08g0548900 PE=2 SV=1 | 6 | 197 | 8.0E-32 |
sp|A2YXU2|PSA7A_ORYSI | Proteasome subunit alpha type-7-A OS=Oryza sativa subsp. indica GN=OsI_029135 PE=2 SV=2 | 6 | 197 | 8.0E-32 |
sp|P34120|PSA7_DICDI | Proteasome subunit alpha type-7 OS=Dictyostelium discoideum GN=psmA7 PE=3 SV=1 | 1 | 197 | 9.0E-32 |
sp|Q9PVY6|PSA7A_XENLA | Proteasome subunit alpha type-7-A OS=Xenopus laevis GN=psma7-a PE=2 SV=1 | 5 | 197 | 1.0E-31 |
sp|Q9PVQ1|PSA7B_XENLA | Proteasome subunit alpha type-7-B OS=Xenopus laevis GN=psma7-b PE=2 SV=1 | 5 | 197 | 1.0E-31 |
sp|Q5V1D4|PSA2_HALMA | Proteasome subunit alpha 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmA2 PE=3 SV=1 | 6 | 173 | 2.0E-31 |
sp|P30186|PSA7A_ARATH | Proteasome subunit alpha type-7-A OS=Arabidopsis thaliana GN=PAD1 PE=1 SV=1 | 6 | 197 | 2.0E-31 |
sp|Q0J006|PSA7B_ORYSJ | Proteasome subunit alpha type-7-B OS=Oryza sativa subsp. japonica GN=PAD1 PE=2 SV=1 | 6 | 197 | 2.0E-31 |
sp|A2Z3I9|PSA7B_ORYSI | Proteasome subunit alpha type-7-B OS=Oryza sativa subsp. indica GN=PAD1 PE=2 SV=1 | 6 | 197 | 2.0E-31 |
sp|O26782|PSA_METTH | Proteasome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmA PE=3 SV=1 | 6 | 163 | 3.0E-31 |
sp|O24030|PSA7_SOLLC | Proteasome subunit alpha type-7 OS=Solanum lycopersicum GN=PAD1 PE=2 SV=1 | 6 | 197 | 5.0E-31 |
sp|Q27575|PSA73_DROME | Proteasome subunit alpha type-7-1B OS=Drosophila melanogaster GN=Prosalpha4T2 PE=2 SV=2 | 4 | 195 | 8.0E-31 |
sp|Q9Z2U1|PSA5_MOUSE | Proteasome subunit alpha type-5 OS=Mus musculus GN=Psma5 PE=1 SV=1 | 1 | 215 | 8.0E-31 |
sp|P28066|PSA5_HUMAN | Proteasome subunit alpha type-5 OS=Homo sapiens GN=PSMA5 PE=1 SV=3 | 1 | 215 | 8.0E-31 |
sp|Q5E987|PSA5_BOVIN | Proteasome subunit alpha type-5 OS=Bos taurus GN=PSMA5 PE=1 SV=1 | 1 | 215 | 8.0E-31 |
sp|Q9YC01|PSA_AERPE | Proteasome subunit alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmA PE=3 SV=1 | 3 | 204 | 1.0E-30 |
sp|Q9V2V5|PSA2_HALVD | Proteasome subunit alpha 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmA2 PE=1 SV=1 | 1 | 173 | 1.0E-30 |
sp|B8GEZ3|PSA_METPE | Proteasome subunit alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmA PE=3 SV=1 | 2 | 219 | 2.0E-30 |
sp|P48004|PSA7_RAT | Proteasome subunit alpha type-7 OS=Rattus norvegicus GN=Psma7 PE=1 SV=1 | 5 | 197 | 2.0E-30 |
sp|Q5VRG3|PSA4B_ORYSJ | Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. japonica GN=Os06g0167600 PE=2 SV=1 | 6 | 212 | 3.0E-30 |
sp|P0C8Y9|PSA4B_ORYSI | Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. indica GN=OsI_021067 PE=1 SV=1 | 6 | 212 | 3.0E-30 |
sp|P0C1G8|PSA4A_ORYSJ | Proteasome subunit alpha type-4-1 OS=Oryza sativa subsp. japonica GN=PAC1 PE=2 SV=1 | 6 | 212 | 3.0E-30 |
sp|A2Y9X7|PSA4A_ORYSI | Proteasome subunit alpha type-4-1 OS=Oryza sativa subsp. indica GN=OsI_021120 PE=1 SV=2 | 6 | 212 | 3.0E-30 |
sp|O23715|PSA3_ARATH | Proteasome subunit alpha type-3 OS=Arabidopsis thaliana GN=PAG1 PE=1 SV=2 | 4 | 174 | 4.0E-30 |
sp|O13268|PSA7_CHICK | Proteasome subunit alpha type-7 OS=Gallus gallus GN=PSMA7 PE=2 SV=1 | 5 | 197 | 6.0E-30 |
sp|P40303|PSA4_YEAST | Proteasome subunit alpha type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE6 PE=1 SV=1 | 6 | 220 | 6.0E-30 |
sp|Q8X077|PSA2_NEUCR | Probable proteasome subunit alpha type-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pca-2 PE=3 SV=1 | 4 | 226 | 8.0E-30 |
sp|Q9N599|PSA4_CAEEL | Proteasome subunit alpha type-4 OS=Caenorhabditis elegans GN=pas-3 PE=3 SV=2 | 6 | 215 | 8.0E-30 |
sp|O81146|PSA6A_ARATH | Proteasome subunit alpha type-6-A OS=Arabidopsis thaliana GN=PAA1 PE=1 SV=2 | 6 | 218 | 1.0E-29 |
sp|O94579|PSA2_SCHPO | Probable proteasome subunit alpha type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre8 PE=3 SV=1 | 4 | 218 | 1.0E-29 |
sp|O24362|PSA3_SPIOL | Proteasome subunit alpha type-3 OS=Spinacia oleracea GN=PAG1 PE=2 SV=1 | 6 | 174 | 1.0E-29 |
sp|P22769|PSA71_DROME | Proteasome subunit alpha type-7-1 OS=Drosophila melanogaster GN=Prosalpha4 PE=1 SV=2 | 4 | 240 | 1.0E-29 |
sp|Q95005|PSA7_CAEEL | Proteasome subunit alpha type-7 OS=Caenorhabditis elegans GN=pas-4 PE=1 SV=1 | 4 | 173 | 2.0E-29 |
sp|P34064|PSA5_RAT | Proteasome subunit alpha type-5 OS=Rattus norvegicus GN=Psma5 PE=1 SV=1 | 1 | 215 | 3.0E-29 |
sp|Q95083|PSA5_DROME | Proteasome subunit alpha type-5 OS=Drosophila melanogaster GN=Prosalpha5 PE=2 SV=2 | 1 | 244 | 6.0E-29 |
sp|Q9XG77|PSA6_TOBAC | Proteasome subunit alpha type-6 OS=Nicotiana tabacum GN=PAA1 PE=2 SV=1 | 6 | 221 | 7.0E-29 |
sp|A5UJS2|PSA_METS3 | Proteasome subunit alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmA PE=3 SV=1 | 6 | 215 | 8.0E-29 |
sp|Q54DM7|PSA2_DICDI | Proteasome subunit alpha type-2 OS=Dictyostelium discoideum GN=psmA2 PE=3 SV=1 | 4 | 216 | 9.0E-29 |
sp|P32379|PSA5_YEAST | Proteasome subunit alpha type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP2 PE=1 SV=2 | 1 | 243 | 1.0E-28 |
sp|O48551|PSA6_SOYBN | Proteasome subunit alpha type-6 OS=Glycine max GN=PAA1 PE=2 SV=2 | 6 | 215 | 3.0E-28 |
sp|Q95008|PSA5_CAEEL | Proteasome subunit alpha type-5 OS=Caenorhabditis elegans GN=pas-5 PE=1 SV=1 | 1 | 243 | 7.0E-28 |
sp|Q24178|PSA72_DROME | Proteasome subunit alpha type-7-1A OS=Drosophila melanogaster GN=Prosalpha4T1 PE=2 SV=2 | 4 | 197 | 1.0E-27 |
sp|Q9LSU0|PSA3_ORYSJ | Proteasome subunit alpha type-3 OS=Oryza sativa subsp. japonica GN=PAG1 PE=2 SV=1 | 4 | 174 | 2.0E-27 |
sp|Q10329|PSA4_SCHPO | Probable proteasome subunit alpha type-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre6 PE=3 SV=1 | 6 | 197 | 3.0E-27 |
sp|O16812|PSA73_DROVI | Proteasome subunit alpha type-7-1B OS=Drosophila virilis GN=Pros28.1B PE=2 SV=1 | 8 | 195 | 3.0E-27 |
sp|P25789|PSA4_HUMAN | Proteasome subunit alpha type-4 OS=Homo sapiens GN=PSMA4 PE=1 SV=1 | 6 | 175 | 4.0E-27 |
sp|Q3ZCK9|PSA4_BOVIN | Proteasome subunit alpha type-4 OS=Bos taurus GN=PSMA4 PE=1 SV=1 | 6 | 175 | 4.0E-27 |
sp|P23638|PSA3_YEAST | Proteasome subunit alpha type-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE9 PE=1 SV=1 | 1 | 198 | 4.0E-27 |
sp|P21670|PSA4_RAT | Proteasome subunit alpha type-4 OS=Rattus norvegicus GN=Psma4 PE=1 SV=1 | 6 | 175 | 4.0E-27 |
sp|Q09682|PSA3_SCHPO | Probable proteasome subunit alpha type-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13C5.01c PE=3 SV=1 | 5 | 236 | 4.0E-27 |
sp|Q9R1P0|PSA4_MOUSE | Proteasome subunit alpha type-4 OS=Mus musculus GN=Psma4 PE=1 SV=1 | 6 | 175 | 5.0E-27 |
sp|Q4R932|PSA4_MACFA | Proteasome subunit alpha type-4 OS=Macaca fascicularis GN=PSMA4 PE=2 SV=1 | 6 | 175 | 1.0E-26 |
sp|O81147|PSA6B_ARATH | Proteasome subunit alpha type-6-B OS=Arabidopsis thaliana GN=PAA2 PE=1 SV=1 | 6 | 221 | 1.0E-26 |
sp|O16811|PSA71_DROVI | Proteasome subunit alpha type-7-1 OS=Drosophila virilis GN=Pros28.1 PE=3 SV=1 | 4 | 197 | 2.0E-26 |
sp|Q9V5C6|PSA3_DROME | Proteasome subunit alpha type-3 OS=Drosophila melanogaster GN=Prosalpha7 PE=1 SV=1 | 6 | 174 | 4.0E-26 |
sp|P21242|PSA7_YEAST | Probable proteasome subunit alpha type-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE10 PE=1 SV=2 | 6 | 204 | 5.0E-26 |
sp|Q27563|PSA3_DICDI | Proteasome subunit alpha type-3 OS=Dictyostelium discoideum GN=psmA3 PE=2 SV=2 | 6 | 232 | 1.0E-25 |
sp|Q9LSU3|PSA6_ORYSJ | Proteasome subunit alpha type-6 OS=Oryza sativa subsp. japonica GN=PAA1 PE=2 SV=1 | 6 | 215 | 2.0E-25 |
sp|P18053|PSA4_DROME | Proteasome subunit alpha type-4 OS=Drosophila melanogaster GN=Prosalpha3 PE=1 SV=2 | 6 | 218 | 2.0E-25 |
sp|P60901|PSA6_RAT | Proteasome subunit alpha type-6 OS=Rattus norvegicus GN=Psma6 PE=1 SV=1 | 6 | 218 | 4.0E-25 |
sp|P60900|PSA6_HUMAN | Proteasome subunit alpha type-6 OS=Homo sapiens GN=PSMA6 PE=1 SV=1 | 6 | 218 | 4.0E-25 |
sp|Q2YDE4|PSA6_BOVIN | Proteasome subunit alpha type-6 OS=Bos taurus GN=PSMA6 PE=1 SV=1 | 6 | 218 | 4.0E-25 |
sp|Q58DU5|PSA3_BOVIN | Proteasome subunit alpha type-3 OS=Bos taurus GN=PSMA3 PE=1 SV=3 | 6 | 174 | 6.0E-25 |
sp|P18422|PSA3_RAT | Proteasome subunit alpha type-3 OS=Rattus norvegicus GN=Psma3 PE=1 SV=3 | 6 | 174 | 6.0E-25 |
sp|P25788|PSA3_HUMAN | Proteasome subunit alpha type-3 OS=Homo sapiens GN=PSMA3 PE=1 SV=2 | 6 | 174 | 6.0E-25 |
sp|O70435|PSA3_MOUSE | Proteasome subunit alpha type-3 OS=Mus musculus GN=Psma3 PE=1 SV=3 | 6 | 174 | 7.0E-25 |
sp|Q9QUM9|PSA6_MOUSE | Proteasome subunit alpha type-6 OS=Mus musculus GN=Psma6 PE=1 SV=1 | 6 | 218 | 7.0E-25 |
sp|P25787|PSA2_HUMAN | Proteasome subunit alpha type-2 OS=Homo sapiens GN=PSMA2 PE=1 SV=2 | 1 | 214 | 1.0E-24 |
sp|Q3T0Y5|PSA2_BOVIN | Proteasome subunit alpha type-2 OS=Bos taurus GN=PSMA2 PE=1 SV=3 | 1 | 214 | 1.0E-24 |
sp|P17220|PSA2_RAT | Proteasome subunit alpha type-2 OS=Rattus norvegicus GN=Psma2 PE=1 SV=3 | 1 | 214 | 1.0E-24 |
sp|P49722|PSA2_MOUSE | Proteasome subunit alpha type-2 OS=Mus musculus GN=Psma2 PE=1 SV=3 | 1 | 214 | 1.0E-24 |
sp|Q27488|PSA2_CAEEL | Proteasome subunit alpha type-2 OS=Caenorhabditis elegans GN=pas-2 PE=1 SV=1 | 4 | 214 | 1.0E-23 |
sp|P24495|PSA2_XENLA | Proteasome subunit alpha type-2 OS=Xenopus laevis GN=psma2 PE=2 SV=2 | 1 | 214 | 1.0E-23 |
sp|P90513|PSA3_ACACA | Proteasome subunit alpha type-3 (Fragment) OS=Acanthamoeba castellanii PE=2 SV=1 | 6 | 174 | 2.0E-23 |
sp|O23708|PSA2A_ARATH | Proteasome subunit alpha type-2-A OS=Arabidopsis thaliana GN=PAB1 PE=1 SV=1 | 4 | 218 | 2.0E-23 |
sp|P40301|PSA2_DROME | Proteasome subunit alpha type-2 OS=Drosophila melanogaster GN=Prosalpha2 PE=1 SV=1 | 1 | 214 | 3.0E-23 |
sp|Q10KF0|PSA2_ORYSJ | Proteasome subunit alpha type-2 OS=Oryza sativa subsp. japonica GN=PAB1 PE=2 SV=1 | 4 | 215 | 6.0E-23 |
sp|A2YVR7|PSA2_ORYSI | Proteasome subunit alpha type-2 OS=Oryza sativa subsp. indica GN=PAB1 PE=2 SV=2 | 4 | 215 | 6.0E-23 |
sp|Q8L4A7|PSA2B_ARATH | Proteasome subunit alpha type-2-B OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 | 4 | 218 | 6.0E-23 |
sp|O73672|PSA2_CARAU | Proteasome subunit alpha type-2 OS=Carassius auratus GN=psma2 PE=2 SV=3 | 1 | 214 | 1.0E-22 |
sp|Q54XM7|PSA6_DICDI | Proteasome subunit alpha type-6 OS=Dictyostelium discoideum GN=psmA6 PE=3 SV=1 | 10 | 201 | 1.0E-22 |
sp|O59770|PSA7_SCHPO | Probable proteasome subunit alpha type-7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre10 PE=1 SV=1 | 13 | 214 | 2.0E-22 |
sp|Q9VA12|PSA4L_DROME | Proteasome subunit alpha type-4-like OS=Drosophila melanogaster GN=Prosalpha3T PE=2 SV=1 | 6 | 215 | 3.0E-22 |
sp|Q8SQS5|PSA6_ENCCU | Probable proteasome subunit alpha type-6 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE5 PE=1 SV=2 | 13 | 215 | 3.0E-22 |
sp|P23639|PSA2_YEAST | Proteasome subunit alpha type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE8 PE=1 SV=1 | 4 | 218 | 9.0E-22 |
sp|Q09583|PSA3_CAEEL | Proteasome subunit alpha type-3 OS=Caenorhabditis elegans GN=pas-7 PE=1 SV=3 | 6 | 220 | 8.0E-21 |
sp|Q9XZJ4|PSA6_DROME | Proteasome subunit alpha type-6 OS=Drosophila melanogaster GN=Prosalpha1 PE=1 SV=2 | 6 | 244 | 4.0E-20 |
sp|O94517|PSA1_SCHPO | Probable proteasome subunit alpha type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC646.16 PE=3 SV=1 | 6 | 244 | 4.0E-19 |
sp|Q8SRU3|PSA5_ENCCU | Probable proteasome subunit alpha type-5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PUP2 PE=1 SV=1 | 12 | 202 | 2.0E-17 |
sp|O17586|PSA6_CAEEL | Proteasome subunit alpha type-6 OS=Caenorhabditis elegans GN=pas-1 PE=1 SV=1 | 6 | 207 | 4.0E-17 |
sp|F4JJE5|PSA4B_ARATH | Putative proteasome subunit alpha type-4-B OS=Arabidopsis thaliana GN=PAC2 PE=5 SV=1 | 6 | 218 | 4.0E-16 |
sp|P21243|PSA1_YEAST | Proteasome subunit alpha type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCL1 PE=1 SV=1 | 6 | 214 | 4.0E-16 |
sp|A1RSJ8|PSB1_PYRIL | Proteasome subunit beta 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB1 PE=3 SV=1 | 27 | 202 | 2.0E-14 |
sp|Q8ZST5|PSB2_PYRAE | Proteasome subunit beta 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB2 PE=3 SV=1 | 27 | 202 | 4.0E-14 |
sp|Q8SRU7|PSA3_ENCCU | Probable proteasome subunit alpha type-3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE9 PE=1 SV=1 | 10 | 162 | 8.0E-13 |
sp|Q8TW10|PSB_METKA | Proteasome subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmB PE=3 SV=1 | 29 | 202 | 1.0E-12 |
sp|A4WMZ0|PSB2_PYRAR | Proteasome subunit beta 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB2 PE=3 SV=1 | 27 | 202 | 2.0E-12 |
sp|B1YDJ0|PSB2_PYRNV | Proteasome subunit beta 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB2 PE=3 SV=1 | 27 | 202 | 3.0E-12 |
sp|Q6L181|PSB_PICTO | Proteasome subunit beta OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmB PE=3 SV=1 | 27 | 151 | 3.0E-12 |
sp|A3MXQ6|PSB2_PYRCJ | Proteasome subunit beta 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB2 PE=3 SV=1 | 27 | 202 | 4.0E-12 |
sp|B8GG66|PSB_METPE | Proteasome subunit beta OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmB PE=3 SV=1 | 26 | 202 | 6.0E-12 |
sp|Q9YER0|PSB2_AERPE | Proteasome subunit beta 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB2 PE=3 SV=2 | 29 | 202 | 7.0E-12 |
sp|P28061|PSB_THEAC | Proteasome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmB PE=1 SV=1 | 27 | 151 | 7.0E-12 |
sp|Q97AZ7|PSB_THEVO | Proteasome subunit beta OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmB PE=3 SV=1 | 27 | 151 | 1.0E-11 |
sp|A0RXV1|PSB2_CENSY | Proteasome subunit beta 2 OS=Cenarchaeum symbiosum (strain A) GN=psmB2 PE=3 SV=2 | 27 | 202 | 2.0E-11 |
sp|Q9GU37|PSA1_TRYBB | Proteasome subunit alpha type-1 OS=Trypanosoma brucei brucei PE=2 SV=1 | 1 | 199 | 4.0E-11 |
sp|B6YSW2|PSB1_THEON | Proteasome subunit beta 1 OS=Thermococcus onnurineus (strain NA1) GN=psmB1 PE=3 SV=1 | 31 | 202 | 1.0E-10 |
sp|B8D673|PSB1_DESK1 | Proteasome subunit beta 1 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB1 PE=3 SV=1 | 36 | 197 | 1.0E-10 |
sp|A9A2U7|PSB2_NITMS | Proteasome subunit beta 2 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB2 PE=3 SV=1 | 27 | 202 | 1.0E-10 |
sp|A3DN21|PSB1_STAMF | Proteasome subunit beta 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB1 PE=3 SV=1 | 35 | 202 | 2.0E-10 |
sp|A1RWY6|PSB1_THEPD | Proteasome subunit beta 1 OS=Thermofilum pendens (strain Hrk 5) GN=psmB1 PE=3 SV=1 | 27 | 202 | 5.0E-10 |
sp|A8AB58|PSB2_IGNH4 | Proteasome subunit beta 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB2 PE=3 SV=1 | 23 | 195 | 8.0E-10 |
sp|C5A7L1|PSB1_THEGJ | Proteasome subunit beta 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB1 PE=3 SV=1 | 31 | 227 | 9.0E-10 |
sp|O27270|PSB_METTH | Proteasome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmB PE=3 SV=1 | 31 | 243 | 1.0E-09 |
sp|Q58634|PSB_METJA | Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmB PE=1 SV=1 | 29 | 202 | 1.0E-09 |
sp|Q2NI68|PSB_METST | Proteasome subunit beta OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=psmB PE=3 SV=1 | 36 | 202 | 1.0E-09 |
sp|A3DN27|PSB2_STAMF | Proteasome subunit beta 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB2 PE=3 SV=1 | 33 | 231 | 2.0E-09 |
sp|C9REN7|PSB_METVM | Proteasome subunit beta OS=Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7) GN=psmB PE=3 SV=1 | 31 | 202 | 2.0E-09 |
sp|C7P6N4|PSB_METFA | Proteasome subunit beta OS=Methanocaldococcus fervens (strain DSM 4213 / JCM 157852 / AG86) GN=psmB PE=3 SV=1 | 29 | 202 | 2.0E-09 |
sp|Q8PZ04|PSB_METMA | Proteasome subunit beta OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmB PE=3 SV=1 | 31 | 227 | 2.0E-09 |
sp|A2SS78|PSB_METLZ | Proteasome subunit beta OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=psmB PE=3 SV=1 | 29 | 202 | 4.0E-09 |
sp|A1RX71|PSB2_THEPD | Proteasome subunit beta 2 OS=Thermofilum pendens (strain Hrk 5) GN=psmB2 PE=3 SV=1 | 36 | 216 | 4.0E-09 |
sp|Q9YES4|PSB1_AERPE | Proteasome subunit beta 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB1 PE=3 SV=2 | 32 | 233 | 5.0E-09 |
sp|A3MS44|PSB1_PYRCJ | Proteasome subunit beta 1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB1 PE=3 SV=1 | 33 | 202 | 5.0E-09 |
sp|A7I841|PSB_METB6 | Proteasome subunit beta OS=Methanoregula boonei (strain 6A8) GN=psmB PE=3 SV=1 | 32 | 202 | 6.0E-09 |
sp|D3RX66|PSB_FERPA | Proteasome subunit beta OS=Ferroglobus placidus (strain DSM 10642 / AEDII12DO) GN=psmB PE=3 SV=1 | 27 | 202 | 7.0E-09 |
sp|D3S8M7|PSB_METSF | Proteasome subunit beta OS=Methanocaldococcus sp. (strain FS406-22) GN=psmB PE=3 SV=1 | 29 | 233 | 9.0E-09 |
sp|Q2FQL8|PSB_METHJ | Proteasome subunit beta OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=psmB PE=3 SV=1 | 31 | 202 | 2.0E-08 |
sp|Q5JDJ9|PSB1_THEKO | Proteasome subunit beta 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB1 PE=3 SV=1 | 31 | 202 | 3.0E-08 |
sp|A8MBW0|PSB1_CALMQ | Proteasome subunit beta 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB1 PE=3 SV=1 | 61 | 202 | 3.0E-08 |
sp|A1RTI7|PSB2_PYRIL | Proteasome subunit beta 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB2 PE=3 SV=1 | 33 | 202 | 5.0E-08 |
sp|D3E0A3|PSB_METRM | Proteasome subunit beta OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=psmB PE=3 SV=1 | 31 | 245 | 6.0E-08 |
sp|B1YA36|PSB1_PYRNV | Proteasome subunit beta 1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB1 PE=3 SV=1 | 33 | 202 | 6.0E-08 |
sp|B8D683|PSB2_DESK1 | Proteasome subunit beta 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB2 PE=3 SV=1 | 27 | 202 | 8.0E-08 |
sp|B5IEE5|PSB_ACIB4 | Proteasome subunit beta OS=Aciduliprofundum boonei (strain DSM 19572 / T469) GN=psmB PE=3 SV=1 | 61 | 173 | 9.0E-08 |
sp|B1L6X8|PSB2_KORCO | Proteasome subunit beta 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB2 PE=3 SV=1 | 45 | 202 | 1.0E-07 |
sp|Q8TJB5|PSB_METAC | Proteasome subunit beta OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmB PE=3 SV=1 | 31 | 227 | 1.0E-07 |
sp|A0B5B1|PSB_METTP | Proteasome subunit beta OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=psmB PE=3 SV=1 | 31 | 173 | 1.0E-07 |
sp|A2BN24|PSB1_HYPBU | Proteasome subunit beta 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB1 PE=3 SV=1 | 32 | 224 | 1.0E-07 |
sp|D5EAS6|PSB_METMS | Proteasome subunit beta OS=Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP) GN=psmB PE=3 SV=1 | 31 | 226 | 2.0E-07 |
sp|Q9P992|PSB_METTE | Proteasome subunit beta OS=Methanosarcina thermophila GN=psmB PE=3 SV=1 | 31 | 227 | 2.0E-07 |
sp|Q9P996|PSB_ARCFU | Proteasome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmB PE=1 SV=1 | 27 | 202 | 3.0E-07 |
sp|Q46G14|PSB_METBF | Proteasome subunit beta OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmB PE=3 SV=1 | 31 | 227 | 3.0E-07 |
sp|D4GYZ1|PSB_HALVD | Proteasome subunit beta OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmB PE=1 SV=1 | 23 | 202 | 4.0E-07 |
sp|Q8ZYF2|PSB1_PYRAE | Proteasome subunit beta 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB1 PE=3 SV=1 | 33 | 202 | 5.0E-07 |
sp|A4WH05|PSB1_PYRAR | Proteasome subunit beta 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB1 PE=3 SV=1 | 33 | 202 | 5.0E-07 |
sp|Q12YV7|PSB_METBU | Proteasome subunit beta OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=psmB PE=3 SV=1 | 31 | 227 | 7.0E-07 |
sp|D2RGT4|PSB_ARCPA | Proteasome subunit beta OS=Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18) GN=psmB PE=3 SV=1 | 27 | 173 | 1.0E-06 |
sp|A2BN27|PSB2_HYPBU | Proteasome subunit beta 2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB2 PE=3 SV=1 | 31 | 216 | 2.0E-06 |
sp|A4YIE0|PSB1_METS5 | Proteasome subunit beta 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB1 PE=3 SV=1 | 29 | 173 | 2.0E-06 |
sp|Q4JAY3|PSB1_SULAC | Proteasome subunit beta 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB1 PE=3 SV=1 | 36 | 173 | 3.0E-06 |
sp|P23724|PSB6_YEAST | Proteasome subunit beta type-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE7 PE=1 SV=1 | 31 | 177 | 3.0E-06 |
sp|A8M8R5|PSB2_CALMQ | Proteasome subunit beta 2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB2 PE=3 SV=1 | 36 | 202 | 4.0E-06 |
sp|A8AA46|PSB1_IGNH4 | Proteasome subunit beta 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB1 PE=3 SV=1 | 32 | 174 | 4.0E-06 |
sp|Q975U8|PSB1_SULTO | Proteasome subunit beta 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB1 PE=3 SV=1 | 36 | 211 | 6.0E-06 |
sp|A3CUS9|PSB_METMJ | Proteasome subunit beta OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=psmB PE=3 SV=1 | 26 | 202 | 7.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0005839 | proteasome core complex | Yes |
GO:0006511 | ubiquitin-dependent protein catabolic process | Yes |
GO:0051603 | proteolysis involved in protein catabolic process | Yes |
GO:0019773 | proteasome core complex, alpha-subunit complex | Yes |
GO:0009056 | catabolic process | No |
GO:0043170 | macromolecule metabolic process | No |
GO:0008150 | biological_process | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0032991 | protein-containing complex | No |
GO:0044238 | primary metabolic process | No |
GO:0006508 | proteolysis | No |
GO:0019941 | modification-dependent protein catabolic process | No |
GO:0008152 | metabolic process | No |
GO:0044237 | cellular metabolic process | No |
GO:0044260 | cellular macromolecule metabolic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0009987 | cellular process | No |
GO:0044265 | cellular macromolecule catabolic process | No |
GO:0019538 | protein metabolic process | No |
GO:0005575 | cellular_component | No |
GO:0044248 | cellular catabolic process | No |
GO:0009057 | macromolecule catabolic process | No |
GO:1901575 | organic substance catabolic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0043632 | modification-dependent macromolecule catabolic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 48 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophio5|3326 MFRNNYDNDSVTFSPQGRIFQIEYAAEAVKQGSVVVGIASKTHAVLCAVKRNAEELSSYQKKLFSIDEHAGIAIA GLTSDARVLSNFMKQQCLGHRLTYGRAMPIRSFVNMIGDKAQTNTQFYGKRPYGVGLLVAGVDEKGPHLYEFQPS GMTEEMTAFAIGARSQMARTYLERNIDAFADCSREELVKHGLKALRESLVQDKELTVDNTSVGVVGVETDPNKGI EPFKLYDGDDMQPWIQSLGSEAQGGGGGGGEGEGEGEVEGMDVDS |
Coding | >Ophio5|3326 ATGTTTCGGAACAACTACGACAACGACTCCGTCACCTTCTCGCCCCAGGGCCGCATCTTCCAGATCGAGTATGCG GCCGAGGCGGTCAAGCAGGGATCCGTCGTCGTCGGAATAGCCAGCAAGACGCACGCTGTTCTCTGTGCCGTCAAG AGAAACGCCGAGGAGCTGTCTTCCTATCAAAAGAAGCTCTTTTCCATCGACGAGCACGCCGGAATCGCCATCGCC GGTCTTACATCGGACGCCCGCGTCTTGTCCAACTTTATGAAACAGCAGTGCCTCGGCCACCGGCTGACGTATGGT CGCGCCATGCCCATACGCTCATTTGTCAACATGATCGGCGACAAGGCCCAGACAAACACGCAGTTCTACGGCAAG CGGCCCTACGGCGTCGGTCTGCTGGTCGCCGGCGTGGACGAGAAGGGTCCCCATCTGTACGAGTTTCAGCCATCG GGCATGACGGAGGAGATGACGGCCTTTGCCATCGGCGCTCGTTCCCAGATGGCACGCACCTACCTGGAGCGCAAC ATCGACGCCTTTGCAGATTGCTCGCGGGAGGAGCTGGTTAAGCACGGCCTCAAGGCTCTGCGAGAGAGCCTGGTG CAGGATAAGGAGCTGACGGTGGACAATACGTCGGTCGGCGTCGTGGGCGTCGAGACGGACCCTAACAAGGGAATT GAGCCGTTCAAGCTCTACGATGGGGACGACATGCAGCCGTGGATTCAGAGCTTGGGGAGTGAGGCGCAGGGCGGT GGCGGTGGCGGTGGAGAGGGTGAGGGTGAGGGTGAGGTTGAGGGTATGGACGTTGACAGC |
Transcript | >Ophio5|3326 ATGTTTCGGAACAACTACGACAACGACTCCGTCACCTTCTCGCCCCAGGGCCGCATCTTCCAGATCGAGTATGCG GCCGAGGCGGTCAAGCAGGGATCCGTCGTCGTCGGAATAGCCAGCAAGACGCACGCTGTTCTCTGTGCCGTCAAG AGAAACGCCGAGGAGCTGTCTTCCTATCAAAAGAAGCTCTTTTCCATCGACGAGCACGCCGGAATCGCCATCGCC GGTCTTACATCGGACGCCCGCGTCTTGTCCAACTTTATGAAACAGCAGTGCCTCGGCCACCGGCTGACGTATGGT CGCGCCATGCCCATACGCTCATTTGTCAACATGATCGGCGACAAGGCCCAGACAAACACGCAGTTCTACGGCAAG CGGCCCTACGGCGTCGGTCTGCTGGTCGCCGGCGTGGACGAGAAGGGTCCCCATCTGTACGAGTTTCAGCCATCG GGCATGACGGAGGAGATGACGGCCTTTGCCATCGGCGCTCGTTCCCAGATGGCACGCACCTACCTGGAGCGCAAC ATCGACGCCTTTGCAGATTGCTCGCGGGAGGAGCTGGTTAAGCACGGCCTCAAGGCTCTGCGAGAGAGCCTGGTG CAGGATAAGGAGCTGACGGTGGACAATACGTCGGTCGGCGTCGTGGGCGTCGAGACGGACCCTAACAAGGGAATT GAGCCGTTCAAGCTCTACGATGGGGACGACATGCAGCCGTGGATTCAGAGCTTGGGGAGTGAGGCGCAGGGCGGT GGCGGTGGCGGTGGAGAGGGTGAGGGTGAGGGTGAGGTTGAGGGTATGGACGTTGACAGCTGA |
Gene | >Ophio5|3326 ATGTTTCGGAACAACTACGACAACGACTCCGTCACCTTGTGAGAATCCCTCGACGTGAATGTGACTTTGGCTCGA AGCTGACCGGCTTGCCTTCAGCTCGCCCCAGGGCCGCATCTTCCAGATCGAGTATGCGGCCGAGGCGGTCAAGCA GGGATCCGTCGTCGTCGGAATAGCCAGCAAGACGCACGCTGTTCTCTGTGCCGTCAAGGTTCGAGAGGACACACG ACTTGATTGGTTCATGGCTGACCCTTTCCCCGGCAGAGAAACGCCGAGGAGCTGTCTTCCTATCAAAAGAAGCTC TTTTCCATCGACGAGCACGCCGGAATCGCCATCGCCGGTCTTACATCGGACGCCCGCGTCTTGTCCAACTTTATG AAACAGCAGTGCCTCGGCCACCGGCTGACGTATGGTCGCGCCATGCCCATACGCTCATTTGTCAACATGATCGGC GACAAGGCCCAGACAAACACGCAGTTCTACGGCAAGCGGCCCTACGGCGTCGGTCTGCTGGTCGCCGGCGTGGAC GAGAAGGGTCCCCATCTGTACGAGTTTCAGCCATCGGGCATGACGGAGGAGATGACGGCCTTTGCCATCGGCGCT CGTTCCCAGATGGCACGCACCTACCTGGAGCGCAACATCGACGCCTTTGCAGATTGCTCGCGGGAGGAGCTGGTT AAGCACGGCCTCAAGGCTCTGCGAGAGAGCCTGGTGCAGGATAAGGAGCTGACGGTGGACAATACGTCGGTCGGC GTCGTGGGCGTCGAGACGGACCCTAACAAGGGAATTGAGCCGTTCAAGCTCTACGATGGGGACGACATGCAGCCG TGGATTCAGAGCTTGGGGAGTGAGGCGCAGGGCGGTGGCGGTGGCGGTGGAGAGGGTGAGGGTGAGGGTGAGGTT GAGGGTATGGACGTTGACAGCTGA |