Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|330
Gene name
Locationscaffold_1073:1515..3572
Strand+
Gene length (bp)2057
Transcript length (bp)1914
Coding sequence length (bp)1911
Protein length (aa) 637

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08733 PalH PalH/RIM21 5.4E-114 38 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RY98|PALH_NEUCR pH-response regulator protein palH/prr-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-4 PE=3 SV=1 72 439 4.0E-158
sp|Q52E66|PALH_MAGO7 pH-response regulator protein palH/RIM21 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM21 PE=3 SV=1 16 392 7.0E-157
sp|Q9P904|PALH_EMENI pH-response regulator protein palH/RIM21 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palH PE=3 SV=1 7 441 4.0E-129
sp|Q5V9L7|PALH_BOTFB pH-response regulator protein palH/RIM21 OS=Botryotinia fuckeliana (strain B05.10) GN=palH PE=3 SV=2 71 455 2.0E-127
sp|Q9UVF6|PALH_YARLI pH-response regulator protein palH/RIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM21 PE=3 SV=2 76 376 1.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RY98|PALH_NEUCR pH-response regulator protein palH/prr-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-4 PE=3 SV=1 72 439 4.0E-158
sp|Q52E66|PALH_MAGO7 pH-response regulator protein palH/RIM21 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM21 PE=3 SV=1 16 392 7.0E-157
sp|Q9P904|PALH_EMENI pH-response regulator protein palH/RIM21 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palH PE=3 SV=1 7 441 4.0E-129
sp|Q5V9L7|PALH_BOTFB pH-response regulator protein palH/RIM21 OS=Botryotinia fuckeliana (strain B05.10) GN=palH PE=3 SV=2 71 455 2.0E-127
sp|Q9UVF6|PALH_YARLI pH-response regulator protein palH/RIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM21 PE=3 SV=2 76 376 1.0E-42
sp|Q6BPR6|PALH_DEBHA pH-response regulator protein palH/RIM21 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RIM21 PE=3 SV=2 82 382 1.0E-16
sp|Q6CXK7|PALH_KLULA pH-response regulator protein palH/RIM21 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RIM21 PE=3 SV=1 81 373 8.0E-15
sp|Q758G4|PALH_ASHGO pH-response regulator protein palH/RIM21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RIM21 PE=3 SV=1 81 373 3.0E-13
sp|P48565|PALH_YEAST pH-response regulator protein palH/RIM21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM21 PE=1 SV=1 137 372 4.0E-12
sp|Q59YK4|PALH_CANAL pH-response regulator protein palH/RIM21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIM21 PE=3 SV=1 57 382 5.0E-09
sp|Q6FJT9|PALH_CANGA pH-response regulator protein palH/RIM21 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RIM21 PE=3 SV=1 166 372 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 87 109 22
2 221 243 22
3 258 280 22
4 300 317 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|330
METLTYPSTTLAAPTLCTTTSLVPAKGFLAMTDGPSSQTVIYEVPCPTSNPVGAAAVIAAEQRADTHDSSSDTRF
SDFRDPFYASTFPICYALAAATVTAYMLLIMLFITPRSFLDGGVVYLGRRRGFTHSSSGGENIGGRPWLQKVAAL
TVAVSLTIATHDTFKVAQRQYQWGVQNAGVLQSAVMGSTELRVIRLISNTFLWLAQAQTLIRLFPRHREKVIIKW
AAFALITLDLIFSALNSFNDRYPNPMGGSFDHPIPALSYLFQLLLGVLYAAWVIYYSLMKKRYAFYHPLMKNMPL
LAIISLTSILIPVVFFIMDISKPEFTGWGDYVRWVGAAAASVIVWEWVERIEALEREEKKDGILGREVFDGDDTL
EVNASEFPWLRHRRHRKAGDGACMGDDYYHHHAHGGGDGQRDQWPLRSNGWPGVSAITGRQRAQARHVGYDIEDA
RPPGIDAGCASADGRRRGAGRPNESLDGLGAGYEPRAGAGVGEAEAVARADDTGSEPAGVVGRQGEGGGGGDASA
DDTRHTRVAGRAGRRGPMGHTFTTGAIRGESGGEAPGEAAADDGHGEPAGDGNTGAAAAGHGAAAGAGGGVGGER
ERVRDAGGDGGQLDGGRRGVDESAAMARSTARTGAGV
Coding >Ophio5|330
ATGGAGACATTGACCTATCCCTCGACGACGTTGGCGGCGCCGACGCTGTGCACAACCACCAGCTTGGTGCCCGCC
AAGGGCTTCTTGGCAATGACGGACGGTCCATCCTCCCAAACCGTCATCTACGAGGTGCCTTGCCCGACGTCCAAC
CCTGTCGGCGCTGCCGCCGTCATTGCCGCCGAGCAGAGAGCCGACACGCACGACAGCTCGTCCGATACGCGCTTC
TCCGACTTTCGCGACCCCTTCTATGCATCCACATTTCCTATCTGCTACGCCCTCGCTGCCGCGACGGTGACGGCT
TACATGCTTCTCATCATGCTCTTCATCACCCCGCGATCCTTTCTCGACGGCGGCGTCGTCTACCTCGGCCGCCGC
CGCGGCTTCACCCATAGCTCCTCGGGCGGAGAGAATATCGGCGGCCGCCCCTGGCTGCAAAAGGTGGCGGCCCTC
ACCGTGGCCGTGTCCCTGACCATTGCTACCCACGACACCTTCAAGGTGGCCCAGCGCCAGTACCAATGGGGTGTC
CAGAACGCCGGCGTGCTGCAGAGCGCCGTCATGGGCAGCACCGAGCTCAGGGTCATCCGGCTCATCTCCAATACC
TTTCTTTGGCTCGCTCAGGCCCAGACGCTGATCCGGCTCTTCCCCCGCCACCGGGAAAAGGTGATAATAAAATGG
GCCGCCTTTGCTCTCATCACGCTCGACCTCATCTTCAGCGCCCTCAACAGCTTCAACGACCGGTACCCGAACCCC
ATGGGCGGCAGCTTCGACCACCCGATCCCCGCCCTCAGCTACCTCTTCCAGCTCCTGCTCGGCGTTCTCTACGCC
GCCTGGGTCATATACTATTCGCTAATGAAGAAGCGTTACGCTTTTTACCACCCGCTAATGAAGAACATGCCGCTC
CTCGCCATCATCTCCCTGACGTCGATCCTCATCCCCGTCGTCTTCTTCATCATGGACATATCAAAGCCCGAGTTC
ACCGGCTGGGGCGACTATGTACGGTGGGTGGGCGCCGCGGCTGCCAGCGTCATCGTCTGGGAGTGGGTCGAGCGC
ATCGAGGCGCTGGAGCGCGAGGAGAAGAAGGACGGCATCCTCGGGCGCGAGGTGTTTGACGGCGACGACACGCTC
GAGGTGAACGCGTCCGAGTTCCCTTGGCTGCGCCACCGCCGGCACCGCAAGGCCGGCGACGGCGCCTGCATGGGA
GACGACTACTACCACCACCATGCTCACGGCGGCGGCGACGGACAGCGCGACCAGTGGCCGCTCCGCAGCAACGGG
TGGCCCGGGGTGTCGGCCATTACGGGCCGGCAGCGGGCGCAGGCGCGGCACGTCGGATACGACATCGAGGACGCC
CGACCTCCCGGCATCGACGCCGGATGCGCATCCGCTGACGGACGACGACGTGGTGCGGGGCGCCCCAACGAGAGT
CTCGATGGACTTGGCGCCGGCTACGAGCCCCGCGCCGGGGCCGGTGTCGGGGAGGCCGAGGCGGTGGCGCGCGCT
GACGACACTGGGAGCGAGCCCGCCGGCGTCGTCGGGCGACAAGGAGAAGGAGGCGGAGGAGGCGATGCATCGGCT
GACGACACGCGACATACTCGAGTCGCAGGACGGGCGGGACGACGCGGGCCGATGGGACATACGTTCACGACTGGA
GCTATTCGCGGCGAATCAGGCGGAGAAGCTCCGGGAGAAGCTGCGGCCGACGACGGACACGGAGAGCCTGCCGGT
GACGGTAATACCGGCGCCGCCGCGGCAGGGCACGGCGCTGCGGCAGGTGCTGGAGGAGGAGTCGGCGGAGAGCGC
GAGCGGGTCCGAGATGCGGGTGGAGATGGGGGACAGCTGGATGGCGGGAGACGAGGCGTCGACGAATCCGCCGCT
ATGGCCCGGAGTACGGCGCGGACGGGTGCTGGCGTT
Transcript >Ophio5|330
ATGGAGACATTGACCTATCCCTCGACGACGTTGGCGGCGCCGACGCTGTGCACAACCACCAGCTTGGTGCCCGCC
AAGGGCTTCTTGGCAATGACGGACGGTCCATCCTCCCAAACCGTCATCTACGAGGTGCCTTGCCCGACGTCCAAC
CCTGTCGGCGCTGCCGCCGTCATTGCCGCCGAGCAGAGAGCCGACACGCACGACAGCTCGTCCGATACGCGCTTC
TCCGACTTTCGCGACCCCTTCTATGCATCCACATTTCCTATCTGCTACGCCCTCGCTGCCGCGACGGTGACGGCT
TACATGCTTCTCATCATGCTCTTCATCACCCCGCGATCCTTTCTCGACGGCGGCGTCGTCTACCTCGGCCGCCGC
CGCGGCTTCACCCATAGCTCCTCGGGCGGAGAGAATATCGGCGGCCGCCCCTGGCTGCAAAAGGTGGCGGCCCTC
ACCGTGGCCGTGTCCCTGACCATTGCTACCCACGACACCTTCAAGGTGGCCCAGCGCCAGTACCAATGGGGTGTC
CAGAACGCCGGCGTGCTGCAGAGCGCCGTCATGGGCAGCACCGAGCTCAGGGTCATCCGGCTCATCTCCAATACC
TTTCTTTGGCTCGCTCAGGCCCAGACGCTGATCCGGCTCTTCCCCCGCCACCGGGAAAAGGTGATAATAAAATGG
GCCGCCTTTGCTCTCATCACGCTCGACCTCATCTTCAGCGCCCTCAACAGCTTCAACGACCGGTACCCGAACCCC
ATGGGCGGCAGCTTCGACCACCCGATCCCCGCCCTCAGCTACCTCTTCCAGCTCCTGCTCGGCGTTCTCTACGCC
GCCTGGGTCATATACTATTCGCTAATGAAGAAGCGTTACGCTTTTTACCACCCGCTAATGAAGAACATGCCGCTC
CTCGCCATCATCTCCCTGACGTCGATCCTCATCCCCGTCGTCTTCTTCATCATGGACATATCAAAGCCCGAGTTC
ACCGGCTGGGGCGACTATGTACGGTGGGTGGGCGCCGCGGCTGCCAGCGTCATCGTCTGGGAGTGGGTCGAGCGC
ATCGAGGCGCTGGAGCGCGAGGAGAAGAAGGACGGCATCCTCGGGCGCGAGGTGTTTGACGGCGACGACACGCTC
GAGGTGAACGCGTCCGAGTTCCCTTGGCTGCGCCACCGCCGGCACCGCAAGGCCGGCGACGGCGCCTGCATGGGA
GACGACTACTACCACCACCATGCTCACGGCGGCGGCGACGGACAGCGCGACCAGTGGCCGCTCCGCAGCAACGGG
TGGCCCGGGGTGTCGGCCATTACGGGCCGGCAGCGGGCGCAGGCGCGGCACGTCGGATACGACATCGAGGACGCC
CGACCTCCCGGCATCGACGCCGGATGCGCATCCGCTGACGGACGACGACGTGGTGCGGGGCGCCCCAACGAGAGT
CTCGATGGACTTGGCGCCGGCTACGAGCCCCGCGCCGGGGCCGGTGTCGGGGAGGCCGAGGCGGTGGCGCGCGCT
GACGACACTGGGAGCGAGCCCGCCGGCGTCGTCGGGCGACAAGGAGAAGGAGGCGGAGGAGGCGATGCATCGGCT
GACGACACGCGACATACTCGAGTCGCAGGACGGGCGGGACGACGCGGGCCGATGGGACATACGTTCACGACTGGA
GCTATTCGCGGCGAATCAGGCGGAGAAGCTCCGGGAGAAGCTGCGGCCGACGACGGACACGGAGAGCCTGCCGGT
GACGGTAATACCGGCGCCGCCGCGGCAGGGCACGGCGCTGCGGCAGGTGCTGGAGGAGGAGTCGGCGGAGAGCGC
GAGCGGGTCCGAGATGCGGGTGGAGATGGGGGACAGCTGGATGGCGGGAGACGAGGCGTCGACGAATCCGCCGCT
ATGGCCCGGAGTACGGCGCGGACGGGTGCTGGCGTTTGA
Gene >Ophio5|330
ATGGAGACATTGACCTATCCCTCGACGACGTTGGCGGCGCCGACGCTGTGCACAACCACCAGCTTGGTGCCCGCC
AAGGGCTTCTTGGCAATGACGGACGGTCCATCCTCCCAAACCGTCATCTACGAGGTGCCTTGCCCGACGTCCAAC
CCTGTCGGCGCTGCCGCCGTCATTGCCGCCGAGCAGAGAGCCGACACGCACGACAGCTCGTCCGATACGCGCTTC
TCCGACTTTCGCGACCCCTTCTATGCATCCACATTTCCTATCTGCTACGCCCTCGCTGCCGCGACGGTGACGGCT
TACATGCTTCTCATCATGCTCTTCATCACCCCGCGATCCTTTCTCGACGGCGGCGTCGTCTACCTCGGCCGCCGC
CGCGGCTTCACCCATAGCTCCTCGGGCGGAGAGAATATCGGCGGCCGCCCCTGGCTGCAAAAGGTGGCGGCCCTC
ACCGTGGCCGTGTCCCTGACCATTGCTACCCACGACACCTTCAAGGTGGCCCAGCGCCAGTACCAATGGGGTGTC
CAGAACGCCGGCGTGCTGCAGAGCGCCGTCATGGGCAGCACCGAGCTCAGGGTCATCCGGCTCATCTCCAATACC
TTTCTTTGGCTCGCTCAGGCCCAGACGCTGATCCGGCTCTTCCCCCGCCACCGGGAAAAGGTGATAATAAAATGG
GCCGCCTTTGCTCTCATCACGCTCGACCTCATCTTCAGCGCCCTCAACAGCTTCAACGACCGGTACCCGAACCCC
ATGGGCGGCAGCTTCGACCACCCGATCCCCGCCCTCAGCTACCTCTTCCAGCTCCTGCTCGGCGTTCTCTACGCC
GCCTGGGTCATATACTATTCGCTAATGAAGAAGCGTTACGCTTTTTACCACCCGCTAATGAAGAACATGCCGCTC
CTCGCCATCATCTCCCTGACGTCGATCCTCATCCCCGTCGTCTTCTTCATCATGGACATATCAAAGCCCGAGTTC
ACCGGCTGGGGCGACTATGTACGGTGGGTGGGCGCCGCGGCTGCCAGCGTCATCGTCTGGGAGTGGGTCGAGCGC
ATCGAGGCGCTGGAGCGCGAGGAGAAGAAGGACGGCATCCTCGGGCGCGAGGTGTTTGACGGCGACGACACGCTC
GAGGTGAACGCGTCCGAGTTCCCTTGGCTGCGCCACCGCCGGCACCGCAAGGCCGGCGACGGCGCCTGCATGGGA
GACGACTACTACCACCACCATGCTCACGGCGGCGGCGACGGACAGCGCGACCAGTGGCCGCTCCGCAGCAACGGG
TGGCCCGGGGTGTCGGCCATTACGGGCCGGCAGCGGGCGCAGGCGCGTGAGGCGCACGACGTGCCGCGGATCATG
GGCGATATCCTGCGGCCGCCGCTGTGGCCCTCGCGGCCGGCGCCTACGGTCACGCCGGTCAGCCGGACGGACACG
CCGAGCGCGGCCAGCACCGTCTACGCCGTGCGATACCAGGGCACGTCGGATACGACATCGAGGACGCCCGACCTC
CCGGCATCGACGCCGGATGCGCATCCGCTGACGGACGACGACGTGGTGCGGGGCGCCCCAACGAGAGTCTCGATG
GACTTGGCGCCGGCTACGAGCCCCGCGCCGGGGCCGGTGTCGGGGAGGCCGAGGCGGTGGCGCGCGCTGACGACA
CTGGGAGCGAGCCCGCCGGCGTCGTCGGGCGACAAGGAGAAGGAGGCGGAGGAGGCGATGCATCGGCTGACGACA
CGCGACATACTCGAGTCGCAGGACGGGCGGGACGACGCGGGCCGATGGGACATACGTTCACGACTGGAGCTATTC
GCGGCGAATCAGGCGGAGAAGCTCCGGGAGAAGCTGCGGCCGACGACGGACACGGAGAGCCTGCCGGTGACGGTA
ATACCGGCGCCGCCGCGGCAGGGCACGGCGCTGCGGCAGGTGCTGGAGGAGGAGTCGGCGGAGAGCGCGAGCGGG
TCCGAGATGCGGGTGGAGATGGGGGACAGCTGGATGGCGGGAGACGAGGCGTCGACGAATCCGCCGCTATGGCCC
GGAGTACGGCGCGGACGGGTGCTGGCGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail