Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3297
Gene name
Locationscaffold_260:14913..19366
Strand-
Gene length (bp)4453
Transcript length (bp)4341
Coding sequence length (bp)4338
Protein length (aa) 1446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 1.1E-37 466 675
PF01061 ABC2_membrane ABC-2 type transporter 9.1E-37 1136 1344
PF00005 ABC_tran ABC transporter 6.1E-16 162 312
PF00005 ABC_tran ABC transporter 3.1E-15 842 989
PF06422 PDR_CDR CDR ABC transporter 3.1E-17 688 763
PF14510 ABC_trans_N ABC-transporter N-terminal 1.6E-05 52 132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 35 1435 0.0E+00
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 34 1435 0.0E+00
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 37 1436 0.0E+00
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 49 1436 0.0E+00
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 43 1436 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 35 1435 0.0E+00
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 34 1435 0.0E+00
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 37 1436 0.0E+00
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 49 1436 0.0E+00
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 43 1436 0.0E+00
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 88 1441 0.0E+00
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 42 1435 0.0E+00
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 101 1435 0.0E+00
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 50 1436 0.0E+00
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 107 1435 0.0E+00
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 158 1423 0.0E+00
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 16 1434 0.0E+00
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 107 1432 0.0E+00
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 107 1432 0.0E+00
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 103 1420 0.0E+00
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 103 1433 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 103 1420 0.0E+00
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 107 1432 0.0E+00
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 35 1445 0.0E+00
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 107 1428 0.0E+00
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 107 1431 0.0E+00
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 153 1446 1.0E-179
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 121 1435 4.0E-168
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 61 1431 2.0E-155
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 148 1441 5.0E-154
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 155 1079 7.0E-138
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 157 1347 5.0E-133
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 127 1345 8.0E-130
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 129 1347 1.0E-129
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 129 1347 3.0E-129
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 143 1355 1.0E-128
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 151 1345 1.0E-128
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 64 1334 2.0E-128
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 39 1358 2.0E-127
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 151 1345 2.0E-127
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 127 1345 3.0E-127
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 128 1347 4.0E-127
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 32 1350 1.0E-126
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 127 1378 5.0E-125
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 110 1345 5.0E-125
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 32 1353 5.0E-125
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 92 1379 2.0E-123
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 158 1378 4.0E-123
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 151 1345 6.0E-123
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 139 1345 8.0E-123
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 84 1332 8.0E-123
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 129 1345 1.0E-122
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 128 1345 4.0E-122
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 127 1353 8.0E-122
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 151 1345 1.0E-121
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 148 1446 2.0E-121
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 32 1347 1.0E-120
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 117 1332 1.0E-120
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 157 1349 2.0E-120
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 157 1347 3.0E-120
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 157 1345 1.0E-118
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 127 1334 1.0E-118
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 148 1345 7.0E-118
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 151 1345 7.0E-117
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 32 1345 1.0E-115
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 148 1345 2.0E-114
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 101 1347 5.0E-114
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 127 1378 6.0E-112
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 32 1342 8.0E-111
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 127 1347 1.0E-110
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 117 1345 2.0E-110
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 128 1350 8.0E-109
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 141 1087 2.0E-104
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 811 1379 3.0E-79
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 811 1345 2.0E-78
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 814 1354 2.0E-75
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 814 1354 9.0E-74
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 811 1345 2.0E-72
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 169 1291 7.0E-63
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 813 1329 7.0E-57
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 792 1329 3.0E-56
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 813 1441 7.0E-55
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 813 1329 4.0E-54
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 151 689 7.0E-54
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 151 689 9.0E-54
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 763 1443 5.0E-51
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 814 1435 2.0E-50
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 837 1329 2.0E-50
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 769 1443 5.0E-50
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 813 1329 3.0E-49
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 813 1336 8.0E-49
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 839 1446 2.0E-48
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 149 748 6.0E-48
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 787 1325 2.0E-47
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 828 1367 3.0E-47
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 816 1335 7.0E-47
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 848 1325 3.0E-46
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 813 1333 3.0E-46
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 837 1329 6.0E-46
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 803 1332 6.0E-46
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 126 748 8.0E-46
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 149 748 1.0E-45
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 791 1329 1.0E-45
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 837 1332 3.0E-45
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 839 1366 4.0E-45
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 813 1325 5.0E-45
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 149 748 7.0E-45
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 150 748 8.0E-45
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 822 1329 8.0E-45
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 781 1330 1.0E-44
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 775 1357 3.0E-44
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 151 748 7.0E-44
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 798 1336 8.0E-44
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 155 659 2.0E-43
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 785 1289 4.0E-43
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 837 1330 5.0E-43
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 838 1328 7.0E-43
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 791 1329 2.0E-42
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 837 1329 4.0E-42
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 835 1361 5.0E-42
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 837 1260 6.0E-42
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 817 1325 1.0E-41
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 817 1358 2.0E-41
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 803 1335 2.0E-41
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 117 675 3.0E-41
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 835 1330 3.0E-41
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 837 1330 3.0E-40
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 837 1329 6.0E-40
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 839 1330 1.0E-39
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 152 682 3.0E-39
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 817 1333 3.0E-39
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 749 1330 5.0E-38
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 749 1330 6.0E-38
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 847 1349 6.0E-38
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 154 659 1.0E-37
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 155 661 2.0E-37
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 847 1349 2.0E-37
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 837 1038 2.0E-37
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 838 1082 2.0E-37
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 806 1330 3.0E-37
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 775 1090 3.0E-37
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 792 1329 7.0E-37
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 838 1359 1.0E-36
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 127 674 2.0E-36
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 837 1329 4.0E-36
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 127 675 5.0E-36
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 835 1332 1.0E-35
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 847 1273 2.0E-35
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 157 661 4.0E-35
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 155 691 4.0E-35
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 801 1078 4.0E-35
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 157 661 5.0E-35
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 837 1259 1.0E-34
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 155 691 2.0E-34
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 157 757 3.0E-34
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 834 1331 3.0E-34
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 836 1304 3.0E-34
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 155 685 5.0E-34
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 833 1325 5.0E-34
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 158 675 6.0E-34
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 143 685 6.0E-34
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 847 1329 3.0E-33
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 148 682 3.0E-33
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 837 1304 4.0E-33
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 151 659 1.0E-32
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 837 1304 1.0E-32
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 840 1311 2.0E-32
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 817 1255 5.0E-32
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 838 1363 6.0E-32
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 155 685 8.0E-32
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 837 1328 2.0E-31
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 157 748 3.0E-31
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 151 685 5.0E-31
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 832 1367 8.0E-31
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 157 680 8.0E-31
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 838 1371 9.0E-31
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 151 683 1.0E-30
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 144 679 8.0E-30
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 101 682 8.0E-30
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 157 676 1.0E-29
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 838 1376 2.0E-29
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 825 1080 3.0E-29
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 151 683 3.0E-29
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 157 681 3.0E-29
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 66 679 4.0E-29
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 137 682 5.0E-29
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 157 679 6.0E-29
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 149 678 8.0E-29
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 157 679 9.0E-29
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 151 682 2.0E-28
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 158 676 3.0E-28
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 159 676 3.0E-28
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 158 678 4.0E-28
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 151 682 4.0E-28
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 159 677 4.0E-28
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 834 1087 6.0E-28
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 157 692 1.0E-27
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 159 676 2.0E-27
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 162 677 4.0E-27
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 158 675 5.0E-27
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 850 1330 5.0E-27
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 54 681 7.0E-27
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 814 1283 7.0E-27
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 154 692 1.0E-26
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 157 748 2.0E-26
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 157 678 2.0E-26
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 158 714 3.0E-26
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 153 676 3.0E-26
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 157 609 4.0E-26
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 153 676 4.0E-26
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 157 678 5.0E-26
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 839 1371 5.0E-26
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 144 699 5.0E-26
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 97 675 5.0E-26
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 837 1444 6.0E-26
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 155 714 1.0E-25
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 157 679 2.0E-25
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 157 748 3.0E-25
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 65 677 4.0E-25
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 151 675 5.0E-25
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 151 675 5.0E-25
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 157 743 5.0E-25
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 157 679 6.0E-25
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 157 679 6.0E-25
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 158 675 6.0E-25
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 157 395 6.0E-25
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 151 675 1.0E-24
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 144 678 3.0E-24
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 146 675 8.0E-24
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 157 700 1.0E-23
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 157 395 1.0E-23
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 155 596 2.0E-23
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 157 676 3.0E-23
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 152 388 3.0E-23
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 159 751 3.0E-23
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 152 679 4.0E-23
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 154 395 6.0E-23
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 144 699 1.0E-22
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 158 676 1.0E-22
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 835 1331 1.0E-22
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 142 679 2.0E-22
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 157 377 2.0E-22
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 150 692 2.0E-22
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 151 757 3.0E-22
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 144 693 3.0E-22
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 158 675 4.0E-22
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 135 679 4.0E-22
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 157 679 5.0E-22
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 150 752 9.0E-22
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 155 682 2.0E-21
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 1136 1443 1.0E-20
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 767 1335 2.0E-20
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 157 660 2.0E-20
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 157 679 1.0E-19
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 817 1006 1.0E-19
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 150 687 2.0E-19
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 155 404 7.0E-19
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 816 1006 2.0E-17
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 157 381 5.0E-17
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 157 418 1.0E-16
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 819 1044 7.0E-16
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 813 1090 1.0E-14
sp|Q8KZR4|TAUB_PSEPU Taurine import ATP-binding protein TauB OS=Pseudomonas putida GN=tauB PE=3 SV=1 816 1041 2.0E-14
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 157 401 3.0E-14
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 787 1037 6.0E-14
sp|Q88RA1|TAUB_PSEPK Taurine import ATP-binding protein TauB OS=Pseudomonas putida (strain KT2440) GN=tauB PE=3 SV=1 816 1041 6.0E-14
sp|Q1IGM2|TAUB_PSEE4 Taurine import ATP-binding protein TauB OS=Pseudomonas entomophila (strain L48) GN=tauB PE=3 SV=1 816 1041 8.0E-14
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 778 1037 1.0E-13
sp|Q9KL34|HMUV_VIBCH Hemin import ATP-binding protein HmuV OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hmuV PE=3 SV=2 835 1040 4.0E-13
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 816 1044 5.0E-13
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 1132 1446 9.0E-13
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 833 1037 9.0E-13
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 839 1037 9.0E-13
sp|Q9CL63|RBSA2_PASMU Ribose import ATP-binding protein RbsA 2 OS=Pasteurella multocida (strain Pm70) GN=rbsA2 PE=3 SV=1 835 1053 9.0E-13
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 150 328 1.0E-12
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 735 1037 1.0E-12
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 1148 1359 2.0E-12
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 735 1037 2.0E-12
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 155 661 3.0E-12
sp|Q2T8T6|RBSA2_BURTA Ribose import ATP-binding protein RbsA 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rbsA2 PE=3 SV=1 838 1051 3.0E-12
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 835 1037 3.0E-12
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 835 1037 3.0E-12
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 840 1050 6.0E-12
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 835 1037 8.0E-12
sp|Q3ATR5|MACB_CHLCH Macrolide export ATP-binding/permease protein MacB OS=Chlorobium chlorochromatii (strain CaD3) GN=macB PE=3 SV=1 850 1037 9.0E-12
sp|Q5L5Z1|METN_CHLAB Methionine import ATP-binding protein MetN OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=metN PE=3 SV=1 141 369 9.0E-12
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 735 1037 1.0E-11
sp|Q3JHZ1|RBSA2_BURP1 Ribose import ATP-binding protein RbsA 2 OS=Burkholderia pseudomallei (strain 1710b) GN=rbsA2 PE=3 SV=1 838 1051 2.0E-11
sp|Q63P06|RBSA_BURPS Ribose import ATP-binding protein RbsA OS=Burkholderia pseudomallei (strain K96243) GN=rbsA PE=3 SV=1 838 1051 2.0E-11
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 850 1037 2.0E-11
sp|Q83F44|METN_COXBU Methionine import ATP-binding protein MetN OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=metN PE=3 SV=1 159 363 2.0E-11
sp|P38045|NRTC_SYNE7 Nitrate transport ATP-binding protein NrtC OS=Synechococcus elongatus (strain PCC 7942) GN=nrtC PE=3 SV=1 823 1037 2.0E-11
sp|Q39CJ6|TAUB_BURL3 Taurine import ATP-binding protein TauB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tauB PE=3 SV=1 830 1040 3.0E-11
sp|P63354|CYSA_BRUSU Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella suis biovar 1 (strain 1330) GN=cysA PE=3 SV=1 144 368 4.0E-11
sp|P63353|CYSA_BRUME Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=cysA PE=3 SV=1 144 368 4.0E-11
sp|Q8U3E0|Y528_PYRFU Putative ABC transporter ATP-binding protein PF0528 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0528 PE=3 SV=1 835 1047 4.0E-11
sp|A0KAV6|TAUB_BURCH Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain HI2424) GN=tauB PE=3 SV=1 830 1040 4.0E-11
sp|Q1BT84|TAUB_BURCA Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain AU 1054) GN=tauB PE=3 SV=1 830 1040 4.0E-11
sp|Q13KX9|TAUB2_BURXL Taurine import ATP-binding protein TauB 2 OS=Burkholderia xenovorans (strain LB400) GN=tauB2 PE=3 SV=1 830 1059 6.0E-11
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 144 372 6.0E-11
sp|Q399M3|MACB_BURL3 Macrolide export ATP-binding/permease protein MacB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=macB PE=3 SV=1 839 1026 6.0E-11
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 843 1046 6.0E-11
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 835 1037 6.0E-11
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 850 1005 6.0E-11
sp|Q12B04|METN_POLSJ Methionine import ATP-binding protein MetN OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=metN PE=3 SV=1 162 396 7.0E-11
sp|Q8PY26|Y1038_METMA Putative ABC transporter ATP-binding protein MM_1038 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1038 PE=3 SV=2 840 1044 7.0E-11
sp|Q50801|Y583_METTM Putative ABC transporter ATP-binding protein MTBMA_c05830 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c05830 PE=3 SV=2 840 1047 9.0E-11
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 150 328 1.0E-10
sp|Q48C94|TAUB_PSE14 Taurine import ATP-binding protein TauB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tauB PE=3 SV=1 834 1040 1.0E-10
sp|Q70GD4|HMUV_PHODP Hemin import ATP-binding protein HmuV OS=Photobacterium damsela subsp. piscicida GN=hmuV PE=3 SV=1 835 1037 1.0E-10
sp|Q8TI15|Y4342_METAC Putative ABC transporter ATP-binding protein MA_4342 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4342 PE=3 SV=1 840 1044 1.0E-10
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 144 372 1.0E-10
sp|Q2NSR0|HMUV_SODGM Hemin import ATP-binding protein HmuV OS=Sodalis glossinidius (strain morsitans) GN=hmuV PE=3 SV=1 835 1037 1.0E-10
sp|Q2SB47|HMUV_HAHCH Hemin import ATP-binding protein HmuV OS=Hahella chejuensis (strain KCTC 2396) GN=hmuV PE=3 SV=1 837 1044 1.0E-10
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 144 362 1.0E-10
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 850 1037 1.0E-10
sp|Q7MFA1|HMUV_VIBVY Hemin import ATP-binding protein HmuV OS=Vibrio vulnificus (strain YJ016) GN=hmuV PE=3 SV=1 835 1041 2.0E-10
sp|Q8ENB3|RBSA_OCEIH Ribose import ATP-binding protein RbsA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rbsA PE=3 SV=1 835 1037 2.0E-10
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 835 1041 2.0E-10
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 816 1061 2.0E-10
sp|A1URR2|UGPC_BARBK sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ugpC PE=3 SV=1 839 1037 2.0E-10
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 835 1041 2.0E-10
sp|Q8X5Q4|RBSA2_ECO57 Ribose import ATP-binding protein RbsA 2 OS=Escherichia coli O157:H7 GN=rbsA2 PE=3 SV=3 840 1037 2.0E-10
sp|Q254K9|METN_CHLFF Methionine import ATP-binding protein MetN OS=Chlamydophila felis (strain Fe/C-56) GN=metN PE=3 SV=1 142 370 3.0E-10
sp|A0B212|MACB_BURCH Macrolide export ATP-binding/permease protein MacB OS=Burkholderia cenocepacia (strain HI2424) GN=macB PE=3 SV=1 839 1026 3.0E-10
sp|Q1BPZ6|MACB_BURCA Macrolide export ATP-binding/permease protein MacB OS=Burkholderia cenocepacia (strain AU 1054) GN=macB PE=3 SV=2 839 1026 3.0E-10
sp|Q6HBS0|METN2_BACHK Methionine import ATP-binding protein MetN 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metN2 PE=3 SV=1 169 372 3.0E-10
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 835 1037 4.0E-10
sp|Q4QK57|POTA_HAEI8 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain 86-028NP) GN=potA PE=3 SV=2 835 1037 4.0E-10
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 835 1037 4.0E-10
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 847 1037 4.0E-10
sp|Q4KK16|TAUB_PSEF5 Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tauB PE=3 SV=1 816 1041 4.0E-10
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 847 1040 4.0E-10
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 847 1021 4.0E-10
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 840 1037 4.0E-10
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 835 1041 4.0E-10
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 835 1041 4.0E-10
sp|Q6LQC0|HMUV_PHOPR Hemin import ATP-binding protein HmuV OS=Photobacterium profundum GN=hmuV PE=3 SV=1 835 1037 4.0E-10
sp|Q39GY8|RBSA1_BURL3 Ribose import ATP-binding protein RbsA 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rbsA1 PE=3 SV=1 838 1037 4.0E-10
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 167 372 4.0E-10
sp|Q9FLT8|AB12A_ARATH ABC transporter A family member 12 OS=Arabidopsis thaliana GN=ABCA12 PE=3 SV=1 786 1038 5.0E-10
sp|Q3MB44|RBSA_ANAVT Ribose import ATP-binding protein RbsA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rbsA PE=3 SV=1 849 1037 5.0E-10
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 159 369 5.0E-10
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 847 1037 5.0E-10
sp|Q57855|Y412_METJA Uncharacterized ABC transporter ATP-binding protein MJ0412 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0412 PE=3 SV=1 834 1040 5.0E-10
sp|Q8D3S8|HMUV_VIBVU Hemin import ATP-binding protein HmuV OS=Vibrio vulnificus (strain CMCP6) GN=hmuV PE=3 SV=1 835 1041 5.0E-10
sp|P73450|NRTC_SYNY3 Nitrate transport ATP-binding protein NrtC OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nrtC PE=3 SV=1 834 1037 5.0E-10
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 839 1041 6.0E-10
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 835 1034 6.0E-10
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 835 1037 6.0E-10
sp|Q81XL3|METN3_BACAN Methionine import ATP-binding protein MetN 3 OS=Bacillus anthracis GN=metN3 PE=3 SV=1 169 372 6.0E-10
sp|Q815Y7|METN3_BACCR Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN3 PE=3 SV=1 169 372 6.0E-10
sp|Q83MA0|TAUB_SHIFL Taurine import ATP-binding protein TauB OS=Shigella flexneri GN=tauB PE=3 SV=1 835 1041 7.0E-10
sp|Q631Y4|METN3_BACCZ Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ZK / E33L) GN=metN3 PE=3 SV=1 169 372 7.0E-10
sp|Q72Y96|METN3_BACC1 Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN3 PE=3 SV=1 169 372 7.0E-10
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 847 1051 7.0E-10
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 143 363 8.0E-10
sp|Q8PGE8|METN_XANAC Methionine import ATP-binding protein MetN OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metN PE=3 SV=1 168 372 8.0E-10
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 847 1051 8.0E-10
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 847 1051 8.0E-10
sp|Q1GIE5|POTA_RUEST Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria sp. (strain TM1040) GN=potA PE=3 SV=1 840 1037 8.0E-10
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 148 368 8.0E-10
sp|Q5P4W2|MODC_AROAE Molybdenum import ATP-binding protein ModC OS=Aromatoleum aromaticum (strain EbN1) GN=modC PE=3 SV=1 168 383 8.0E-10
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 785 1037 8.0E-10
sp|Q8KFD6|Y391_CHLTE Putative ABC transporter ATP-binding protein CT0391 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0391 PE=3 SV=1 840 1046 8.0E-10
sp|O85818|POTA_AGGAC Spermidine/putrescine import ATP-binding protein PotA OS=Aggregatibacter actinomycetemcomitans GN=potA PE=3 SV=1 835 1037 9.0E-10
sp|A0B344|METN2_BURCH Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain HI2424) GN=metN2 PE=3 SV=1 159 369 1.0E-09
sp|Q1BR30|METN2_BURCA Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN2 PE=3 SV=1 159 369 1.0E-09
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 847 1046 1.0E-09
sp|Q9V2E4|Y130_PYRAB Putative ABC transporter ATP-binding protein PYRAB01300 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01300 PE=3 SV=1 846 1046 1.0E-09
sp|Q0BFU0|RBSA1_BURCM Ribose import ATP-binding protein RbsA 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rbsA1 PE=3 SV=1 838 1040 1.0E-09
sp|Q8P4S7|METN_XANCP Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=metN PE=3 SV=1 168 372 1.0E-09
sp|Q4UQD2|METN_XANC8 Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. campestris (strain 8004) GN=metN PE=3 SV=1 168 372 1.0E-09
sp|Q32IZ6|TAUB_SHIDS Taurine import ATP-binding protein TauB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tauB PE=3 SV=1 835 1041 1.0E-09
sp|Q1RFH8|TAUB_ECOUT Taurine import ATP-binding protein TauB OS=Escherichia coli (strain UTI89 / UPEC) GN=tauB PE=3 SV=1 835 1041 1.0E-09
sp|Q0TKS1|TAUB_ECOL5 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tauB PE=3 SV=1 835 1041 1.0E-09
sp|Q8FKF5|TAUB_ECOL6 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tauB PE=3 SV=1 835 1041 1.0E-09
sp|Q9TKX3|CYSA_NEPOL Sulfate/thiosulfate import ATP-binding protein CysA OS=Nephroselmis olivacea GN=cysA PE=3 SV=1 166 423 1.0E-09
sp|P77279|FETA_ECOLI Probable iron export ATP-binding protein FetA OS=Escherichia coli (strain K12) GN=fetA PE=1 SV=1 834 1021 1.0E-09
sp|Q8DPC2|POTA_STRR6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=potA PE=3 SV=1 838 1037 1.0E-09
sp|Q97Q42|POTA_STRPN Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=potA PE=3 SV=1 838 1037 1.0E-09
sp|Q04JW0|POTA_STRP2 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=potA PE=3 SV=1 838 1037 1.0E-09
sp|Q32EY4|POTA_SHIDS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=potA PE=3 SV=1 837 1037 1.0E-09
sp|Q6N798|METN2_RHOPA Methionine import ATP-binding protein MetN 2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metN2 PE=3 SV=1 158 425 1.0E-09
sp|Q63JZ3|TAUB_BURPS Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain K96243) GN=tauB PE=3 SV=1 850 1041 1.0E-09
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 840 1037 1.0E-09
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 148 372 2.0E-09
sp|A0K718|RBSA1_BURCH Ribose import ATP-binding protein RbsA 1 OS=Burkholderia cenocepacia (strain HI2424) GN=rbsA1 PE=3 SV=1 838 1040 2.0E-09
sp|Q1BWN5|RBSA1_BURCA Ribose import ATP-binding protein RbsA 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=rbsA1 PE=3 SV=1 838 1040 2.0E-09
sp|Q02ME3|METN1_PSEAB Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN1 PE=3 SV=1 141 363 2.0E-09
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 840 1037 2.0E-09
sp|P31134|POTG_ECOLI Putrescine transport ATP-binding protein PotG OS=Escherichia coli (strain K12) GN=potG PE=3 SV=2 850 1045 2.0E-09
sp|Q92UV5|FBPC2_RHIME Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhizobium meliloti (strain 1021) GN=fbpC2 PE=3 SV=1 157 362 2.0E-09
sp|O86751|FBPC_STRCO Fe(3+) ions import ATP-binding protein FbpC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fbpC PE=3 SV=1 835 1037 2.0E-09
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 838 1037 2.0E-09
sp|Q38UU0|ECFA2_LACSS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ecfA2 PE=3 SV=1 847 1038 2.0E-09
sp|Q3KJQ7|TAUB_PSEPF Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf0-1) GN=tauB PE=3 SV=1 816 1041 2.0E-09
sp|P39456|TCYC_BACSU L-cystine import ATP-binding protein TcyC OS=Bacillus subtilis (strain 168) GN=tcyC PE=1 SV=4 835 1019 2.0E-09
sp|P40790|POTA_SALTY Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=potA PE=3 SV=2 837 1037 2.0E-09
sp|Q57QC8|POTA_SALCH Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella choleraesuis (strain SC-B67) GN=potA PE=3 SV=1 837 1037 2.0E-09
sp|Q8Z7H7|POTA_SALTI Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella typhi GN=potA PE=3 SV=1 837 1037 2.0E-09
sp|Q5PMK1|POTA_SALPA Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=potA PE=3 SV=1 837 1037 2.0E-09
sp|Q823C4|METN_CHLCV Methionine import ATP-binding protein MetN OS=Chlamydophila caviae (strain GPIC) GN=metN PE=3 SV=1 142 369 2.0E-09
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 835 1038 2.0E-09
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 847 1037 2.0E-09
sp|Q5E5I1|HMUV_VIBF1 Hemin import ATP-binding protein HmuV OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hmuV PE=3 SV=1 835 1037 2.0E-09
sp|Q8Y0X3|METN_RALSO Methionine import ATP-binding protein MetN OS=Ralstonia solanacearum (strain GMI1000) GN=metN PE=3 SV=1 159 443 2.0E-09
sp|Q8U4L3|Y068_PYRFU Putative ABC transporter ATP-binding protein PF0068 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0068 PE=3 SV=1 852 1046 2.0E-09
sp|Q1MQ44|POTA_LAWIP Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1 850 1037 2.0E-09
sp|Q3BNZ3|METN_XANC5 Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=metN PE=3 SV=1 168 372 2.0E-09
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 148 368 3.0E-09
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 148 368 3.0E-09
sp|A2RI02|ECFA2_LACLM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=ecfA2 PE=1 SV=1 838 1037 3.0E-09
sp|Q329G7|RBSA_SHIDS Ribose import ATP-binding protein RbsA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rbsA PE=3 SV=1 840 1037 3.0E-09
sp|Q9K0N7|MACB_NEIMB Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup B (strain MC58) GN=macB PE=3 SV=1 831 1037 3.0E-09
sp|A1B9Q7|UGPC_PARDP sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Paracoccus denitrificans (strain Pd 1222) GN=ugpC PE=3 SV=1 850 1037 3.0E-09
sp|Q3K6R9|HMUV_PSEPF Hemin import ATP-binding protein HmuV OS=Pseudomonas fluorescens (strain Pf0-1) GN=hmuV PE=3 SV=1 835 1041 3.0E-09
sp|Q9RKQ4|HMUV_STRCO Hemin import ATP-binding protein HmuV OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hmuV PE=3 SV=1 835 1018 3.0E-09
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 144 362 3.0E-09
sp|Q3Z2Z3|POTA_SHISS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella sonnei (strain Ss046) GN=potA PE=3 SV=1 837 1037 3.0E-09
sp|Q31ZK0|POTA_SHIBS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella boydii serotype 4 (strain Sb227) GN=potA PE=3 SV=1 837 1037 3.0E-09
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 847 1037 3.0E-09
sp|Q39AT4|METN2_BURL3 Methionine import ATP-binding protein MetN 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN2 PE=3 SV=1 159 369 3.0E-09
sp|Q0T5R2|POTA_SHIF8 Spermidine/putrescine import ATP-binding protein PotA OS=Shigella flexneri serotype 5b (strain 8401) GN=potA PE=3 SV=1 837 1037 3.0E-09
sp|Q88ZJ6|POTA_LACPL Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=potA PE=3 SV=1 835 1037 3.0E-09
sp|Q6G194|UGPC_BARQU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella quintana (strain Toulouse) GN=ugpC PE=3 SV=1 839 1038 3.0E-09
sp|Q8UCM5|HMUV_AGRFC Hemin import ATP-binding protein HmuV OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hmuV PE=3 SV=1 837 1056 4.0E-09
sp|Q659V4|HMUV_PHODD Hemin import ATP-binding protein HmuV OS=Photobacterium damselae subsp. damselae GN=hmuV PE=3 SV=1 835 1037 4.0E-09
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 840 1037 4.0E-09
sp|Q93SS1|HMUV_PLESH Hemin import ATP-binding protein HmuV OS=Plesiomonas shigelloides GN=hmuV PE=3 SV=1 835 1037 4.0E-09
sp|Q0T7M2|TAUB_SHIF8 Taurine import ATP-binding protein TauB OS=Shigella flexneri serotype 5b (strain 8401) GN=tauB PE=3 SV=1 835 1041 4.0E-09
sp|Q62H59|PHNC_BURMA Phosphonates import ATP-binding protein PhnC OS=Burkholderia mallei (strain ATCC 23344) GN=phnC PE=3 SV=1 153 371 4.0E-09
sp|Q30V33|POTA_DESAG Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio alaskensis (strain G20) GN=potA PE=3 SV=1 840 1037 4.0E-09
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 847 1037 5.0E-09
sp|Q664G2|RBSA_YERPS Ribose import ATP-binding protein RbsA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rbsA PE=3 SV=1 835 1037 5.0E-09
sp|Q1IGZ0|METN2_PSEE4 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas entomophila (strain L48) GN=metN2 PE=3 SV=1 169 372 5.0E-09
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 825 1037 5.0E-09
sp|Q7VZ31|LOLD_BORPE Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lolD PE=3 SV=1 839 1037 5.0E-09
sp|Q7W8T0|LOLD_BORPA Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lolD PE=3 SV=1 839 1037 5.0E-09
sp|Q7WK40|LOLD_BORBR Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lolD PE=3 SV=1 839 1037 5.0E-09
sp|Q1RD28|POTA_ECOUT Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli (strain UTI89 / UPEC) GN=potA PE=3 SV=1 837 1037 5.0E-09
sp|A1AA20|POTA_ECOK1 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O1:K1 / APEC GN=potA PE=3 SV=1 837 1037 5.0E-09
sp|Q1CDJ0|RBSA_YERPN Ribose import ATP-binding protein RbsA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rbsA PE=3 SV=1 835 1037 5.0E-09
sp|Q7CG00|RBSA_YERPE Ribose import ATP-binding protein RbsA OS=Yersinia pestis GN=rbsA PE=3 SV=1 835 1037 5.0E-09
sp|Q1C1B8|RBSA_YERPA Ribose import ATP-binding protein RbsA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rbsA PE=3 SV=1 835 1037 5.0E-09
sp|Q88DY1|HMUV_PSEPK Hemin import ATP-binding protein HmuV OS=Pseudomonas putida (strain KT2440) GN=hmuV PE=3 SV=1 835 1037 5.0E-09
sp|P69877|POTA_SHIFL Spermidine/putrescine import ATP-binding protein PotA OS=Shigella flexneri GN=potA PE=3 SV=1 837 1037 5.0E-09
sp|P69874|POTA_ECOLI Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli (strain K12) GN=potA PE=1 SV=1 837 1037 5.0E-09
sp|P69875|POTA_ECOL6 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=potA PE=3 SV=1 837 1037 5.0E-09
sp|Q0TIU8|POTA_ECOL5 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=potA PE=3 SV=1 837 1037 5.0E-09
sp|P69876|POTA_ECO57 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O157:H7 GN=potA PE=3 SV=1 837 1037 5.0E-09
sp|Q1J3P2|RBSA_DEIGD Ribose import ATP-binding protein RbsA OS=Deinococcus geothermalis (strain DSM 11300) GN=rbsA PE=3 SV=1 835 1037 5.0E-09
sp|Q63R24|PHNC_BURPS Phosphonates import ATP-binding protein PhnC OS=Burkholderia pseudomallei (strain K96243) GN=phnC PE=3 SV=2 153 371 5.0E-09
sp|Q3JNY2|PHNC_BURP1 Phosphonates import ATP-binding protein PhnC OS=Burkholderia pseudomallei (strain 1710b) GN=phnC PE=3 SV=1 153 371 5.0E-09
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 840 1037 5.0E-09
sp|Q032H3|ECFA2_LACLS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=ecfA2 PE=3 SV=1 838 1032 5.0E-09
sp|Q28K97|TAUB_JANSC Taurine import ATP-binding protein TauB OS=Jannaschia sp. (strain CCS1) GN=tauB PE=3 SV=1 822 1050 5.0E-09
sp|Q5MZ54|CMPC_SYNP6 Bicarbonate transport ATP-binding protein CmpC OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cmpC PE=3 SV=1 833 1037 5.0E-09
sp|Q55107|CMPC_SYNE7 Bicarbonate transport ATP-binding protein CmpC OS=Synechococcus elongatus (strain PCC 7942) GN=cmpC PE=1 SV=1 833 1037 5.0E-09
sp|Q4KKK8|METN1_PSEF5 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metN1 PE=3 SV=1 169 372 6.0E-09
sp|Q3JKX3|TAUB_BURP1 Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain 1710b) GN=tauB PE=3 SV=1 850 1041 6.0E-09
sp|Q62AW4|TAUB_BURMA Taurine import ATP-binding protein TauB OS=Burkholderia mallei (strain ATCC 23344) GN=tauB PE=3 SV=1 850 1041 6.0E-09
sp|Q03JH1|POTA_STRTD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=potA PE=3 SV=1 838 1037 6.0E-09
sp|Q5M397|POTA_STRT2 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=potA PE=3 SV=1 838 1037 6.0E-09
sp|Q5LYN4|POTA_STRT1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus thermophilus (strain CNRZ 1066) GN=potA PE=3 SV=1 838 1037 6.0E-09
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 835 1037 6.0E-09
sp|Q9Z8Q8|METN_CHLPN Methionine import ATP-binding protein MetN OS=Chlamydia pneumoniae GN=metN PE=3 SV=1 141 362 6.0E-09
sp|Q6G5J0|UGPC_BARHE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ugpC PE=3 SV=1 839 1038 6.0E-09
sp|A1K323|MACB_AZOSB Macrolide export ATP-binding/permease protein MacB OS=Azoarcus sp. (strain BH72) GN=macB PE=3 SV=1 838 1037 6.0E-09
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 482 694 7.0E-09
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 835 1040 7.0E-09
sp|Q5WDP1|METN3_BACSK Methionine import ATP-binding protein MetN 3 OS=Bacillus clausii (strain KSM-K16) GN=metN3 PE=3 SV=1 169 372 7.0E-09
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 154 359 7.0E-09
sp|Q6D645|HMUV_PECAS Hemin import ATP-binding protein HmuV OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hmuV PE=3 SV=1 837 1040 7.0E-09
sp|P07821|FHUC_ECOLI Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Escherichia coli (strain K12) GN=fhuC PE=1 SV=3 837 1044 8.0E-09
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 850 1047 8.0E-09
sp|Q2L0H5|UGPC_BORA1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bordetella avium (strain 197N) GN=ugpC PE=3 SV=1 834 1037 8.0E-09
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 835 1040 8.0E-09
sp|Q8L1U3|HMUV_BORAV Hemin import ATP-binding protein HmuV OS=Bordetella avium GN=hmuV PE=1 SV=1 835 1040 9.0E-09
sp|Q2KUC0|HMUV_BORA1 Hemin import ATP-binding protein HmuV OS=Bordetella avium (strain 197N) GN=hmuV PE=3 SV=1 835 1040 9.0E-09
sp|Q13VD7|METN1_BURXL Methionine import ATP-binding protein MetN 1 OS=Burkholderia xenovorans (strain LB400) GN=metN1 PE=3 SV=1 169 372 9.0E-09
sp|Q9STT5|AB7A_ARATH ABC transporter A family member 7 OS=Arabidopsis thaliana GN=ABCA7 PE=3 SV=2 850 1038 9.0E-09
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 831 1046 9.0E-09
sp|Q146E7|TAUB1_BURXL Taurine import ATP-binding protein TauB 1 OS=Burkholderia xenovorans (strain LB400) GN=tauB1 PE=3 SV=1 826 1040 9.0E-09
sp|Q98DW6|TAUB_RHILO Taurine import ATP-binding protein TauB OS=Rhizobium loti (strain MAFF303099) GN=tauB PE=3 SV=1 851 1041 9.0E-09
sp|Q1MBG4|ARAG_RHIL3 Arabinose import ATP-binding protein AraG OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=araG PE=3 SV=1 840 1037 9.0E-09
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 405 755 1.0E-08
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 154 384 1.0E-08
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 144 363 1.0E-08
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 835 1044 1.0E-08
sp|Q7VV72|METN_BORPE Methionine import ATP-binding protein MetN OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metN PE=3 SV=1 162 368 1.0E-08
sp|Q7W4E1|METN_BORPA Methionine import ATP-binding protein MetN OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metN PE=3 SV=1 162 368 1.0E-08
sp|Q7WFU9|METN_BORBR Methionine import ATP-binding protein MetN OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metN PE=3 SV=1 162 368 1.0E-08
sp|P33982|Y3926_AZOC5 Probable ABC transporter ATP-binding protein AZC_3926 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=AZC_3926 PE=3 SV=1 148 362 1.0E-08
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 144 363 1.0E-08
sp|Q4K5Z7|HMUV_PSEF5 Hemin import ATP-binding protein HmuV OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hmuV PE=3 SV=1 835 1044 1.0E-08
sp|Q3SGJ8|PHNC_THIDA Phosphonates import ATP-binding protein PhnC OS=Thiobacillus denitrificans (strain ATCC 25259) GN=phnC PE=3 SV=1 840 1067 1.0E-08
sp|Q3A558|LOLD_PELCD Lipoprotein-releasing system ATP-binding protein LolD OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lolD PE=3 SV=1 835 1037 1.0E-08
sp|Q84EY8|HMUV_ENTCL Hemin import ATP-binding protein HmuV OS=Enterobacter cloacae GN=hmuV PE=3 SV=1 837 1055 1.0E-08
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 835 1037 1.0E-08
sp|Q87UH7|TAUB_PSESM Taurine import ATP-binding protein TauB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tauB PE=3 SV=1 834 1040 1.0E-08
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 850 1037 1.0E-08
sp|P94420|YCLP_BACSU Uncharacterized ABC transporter ATP-binding protein YclP OS=Bacillus subtilis (strain 168) GN=yclP PE=3 SV=1 835 1044 1.0E-08
sp|Q55462|CMPC_SYNY3 Bicarbonate transport ATP-binding protein CmpC OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cmpC PE=2 SV=1 162 368 1.0E-08
sp|Q9JVR5|MACB_NEIMA Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=macB PE=3 SV=1 831 1037 1.0E-08
sp|Q9I1C8|METN1_PSEAE Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN1 PE=3 SV=1 141 363 1.0E-08
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 144 376 1.0E-08
sp|Q97WT4|Y2030_SULSO Putative ABC transporter ATP-binding protein SSO2030 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2030 PE=3 SV=1 847 1044 1.0E-08
sp|Q2T4S8|ARAG2_BURTA Arabinose import ATP-binding protein AraG 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=araG2 PE=3 SV=1 847 1043 1.0E-08
sp|O32151|YURJ_BACSU Uncharacterized ABC transporter ATP-binding protein YurJ OS=Bacillus subtilis (strain 168) GN=yurJ PE=3 SV=1 840 1037 1.0E-08
sp|Q5X484|METN_LEGPA Methionine import ATP-binding protein MetN OS=Legionella pneumophila (strain Paris) GN=metN PE=3 SV=1 143 363 1.0E-08
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 144 362 1.0E-08
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 144 368 2.0E-08
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 835 1044 2.0E-08
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 835 1044 2.0E-08
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 840 1037 2.0E-08
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 161 368 2.0E-08
sp|P48243|GLUA_CORGL Glutamate transport ATP-binding protein GluA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gluA PE=3 SV=2 840 1037 2.0E-08
sp|Q13LX0|RBSA_BURXL Ribose import ATP-binding protein RbsA OS=Burkholderia xenovorans (strain LB400) GN=rbsA PE=3 SV=1 835 1040 2.0E-08
sp|Q51719|YCOBA_PROFR Putative ABC transporter ATP-binding protein in cobA 5'region OS=Propionibacterium freudenreichii subsp. shermanii PE=3 SV=1 850 1019 2.0E-08
sp|Q2KVK2|METN_BORA1 Methionine import ATP-binding protein MetN OS=Bordetella avium (strain 197N) GN=metN PE=3 SV=1 162 363 2.0E-08
sp|Q0BGD7|RGMG1_BURCM Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=Bamb_1228 PE=3 SV=1 840 1072 2.0E-08
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 837 1045 2.0E-08
sp|Q9CIS8|ECFA2_LACLA Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ecfA2 PE=3 SV=1 838 1037 2.0E-08
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 835 1019 2.0E-08
sp|A3CMQ7|POTA_STRSV Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus sanguinis (strain SK36) GN=potA PE=3 SV=1 839 1037 2.0E-08
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 159 362 2.0E-08
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 839 1044 2.0E-08
sp|A0KE25|RGMG3_BURCH Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 OS=Burkholderia cenocepacia (strain HI2424) GN=Bcen2424_6709 PE=3 SV=1 843 1072 2.0E-08
sp|Q1BGC0|RGMG3_BURCA Putative ribose/galactose/methyl galactoside import ATP-binding protein 3 OS=Burkholderia cenocepacia (strain AU 1054) GN=Bcen_6474 PE=3 SV=1 843 1072 2.0E-08
sp|Q5LVM5|TAUB_RUEPO Taurine import ATP-binding protein TauB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tauB PE=3 SV=1 822 1050 2.0E-08
sp|Q6N9W0|METN1_RHOPA Methionine import ATP-binding protein MetN 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metN1 PE=3 SV=1 151 363 2.0E-08
sp|Q21TR5|RGMG_RHOFT Putative ribose/galactose/methyl galactoside import ATP-binding protein OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=Rfer_3129 PE=3 SV=1 847 1040 2.0E-08
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 169 372 2.0E-08
sp|Q03AH0|POTA_LACC3 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus casei (strain ATCC 334) GN=potA PE=3 SV=1 835 1037 2.0E-08
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 835 1018 2.0E-08
sp|Q2W1R8|MODC_MAGSA Molybdenum import ATP-binding protein ModC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=modC PE=3 SV=1 849 1046 2.0E-08
sp|O68877|HMUV_PSEAE Hemin import ATP-binding protein HmuV OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hmuV PE=3 SV=1 835 1037 2.0E-08
sp|Q02FW7|HMUV_PSEAB Hemin import ATP-binding protein HmuV OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hmuV PE=3 SV=1 835 1037 2.0E-08
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 835 1037 2.0E-08
sp|Q035B3|ECFA2_LACC3 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus casei (strain ATCC 334) GN=ecfA2 PE=1 SV=1 817 1021 2.0E-08
sp|Q87J32|HMUV_VIBPA Hemin import ATP-binding protein HmuV OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hmuV PE=3 SV=2 835 1040 2.0E-08
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 159 418 2.0E-08
sp|A1U0A9|MACB_MARHV Macrolide export ATP-binding/permease protein MacB OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=macB PE=3 SV=1 839 1026 2.0E-08
sp|Q46Y69|METN_CUPPJ Methionine import ATP-binding protein MetN OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=metN PE=3 SV=1 143 372 3.0E-08
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 144 362 3.0E-08
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 144 362 3.0E-08
sp|Q2SY12|METN_BURTA Methionine import ATP-binding protein MetN OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=metN PE=3 SV=1 169 372 3.0E-08
sp|Q98K23|CYSA_RHILO Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhizobium loti (strain MAFF303099) GN=cysA PE=3 SV=1 144 372 3.0E-08
sp|Q21JK3|CCMA_SACD2 Cytochrome c biogenesis ATP-binding export protein CcmA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ccmA PE=3 SV=1 837 1020 3.0E-08
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 144 362 3.0E-08
sp|Q471U2|TAUB_CUPPJ Taurine import ATP-binding protein TauB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tauB PE=3 SV=1 821 1046 3.0E-08
sp|Q5F6V6|MACB_NEIG1 Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=macB PE=3 SV=1 831 1037 3.0E-08
sp|Q5LT05|POTA_RUEPO Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=potA PE=3 SV=1 850 1037 3.0E-08
sp|Q8Y7R4|Y1207_LISMO Putative ABC transporter ATP-binding protein lmo1207 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo1207 PE=3 SV=1 837 1037 3.0E-08
sp|A0L0V9|MACB_SHESA Macrolide export ATP-binding/permease protein MacB OS=Shewanella sp. (strain ANA-3) GN=macB PE=3 SV=1 839 1115 3.0E-08
sp|P70970|ECFA2_BACSU Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus subtilis (strain 168) GN=ecfAB PE=3 SV=1 837 1037 3.0E-08
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 144 363 3.0E-08
sp|Q1CI46|LOLD_YERPN Lipoprotein-releasing system ATP-binding protein LolD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lolD PE=3 SV=1 839 1037 3.0E-08
sp|Q8ZFR4|LOLD_YERPE Lipoprotein-releasing system ATP-binding protein LolD OS=Yersinia pestis GN=lolD PE=3 SV=1 839 1037 3.0E-08
sp|Q1C6Q8|LOLD_YERPA Lipoprotein-releasing system ATP-binding protein LolD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lolD PE=3 SV=1 839 1037 3.0E-08
sp|Q4A8A1|ECFA2_MYCH7 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma hyopneumoniae (strain 7448) GN=ecfA2 PE=3 SV=1 850 1045 3.0E-08
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 1108 1435 4.0E-08
sp|Q5MK06|MACB_NEIGO Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae GN=macB PE=1 SV=1 831 1037 4.0E-08
sp|Q93D97|Y1934_STRMU Putative ABC transporter ATP-binding protein SMU_1934c OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=sdcBA PE=3 SV=1 159 372 4.0E-08
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 847 1037 4.0E-08
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 835 1037 4.0E-08
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 167 372 4.0E-08
sp|Q9CP06|POTA_PASMU Spermidine/putrescine import ATP-binding protein PotA OS=Pasteurella multocida (strain Pm70) GN=potA PE=3 SV=2 835 1037 4.0E-08
sp|Q7NU46|TAUB_CHRVO Taurine import ATP-binding protein TauB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tauB PE=3 SV=1 817 1041 4.0E-08
sp|Q4AA74|ECFA2_MYCHJ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=ecfA2 PE=3 SV=1 850 1045 4.0E-08
sp|Q601T6|ECFA2_MYCH2 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma hyopneumoniae (strain 232) GN=ecfA2 PE=3 SV=1 850 1045 4.0E-08
sp|Q9STT8|AB4A_ARATH ABC transporter A family member 4 OS=Arabidopsis thaliana GN=ABCA4 PE=3 SV=2 805 1031 4.0E-08
sp|O54187|Y5958_STRCO Putative ABC transporter ATP-binding protein SCO5958 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5958 PE=3 SV=1 839 1040 4.0E-08
sp|Q05596|CBIO_SALTY Cobalt import ATP-binding protein CbiO OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cbiO PE=1 SV=2 842 1037 4.0E-08
sp|Q1I7I9|MACB2_PSEE4 Macrolide export ATP-binding/permease protein MacB 2 OS=Pseudomonas entomophila (strain L48) GN=macB2 PE=3 SV=1 847 1040 4.0E-08
sp|Q70YG7|HMUV_VIBA7 Hemin import ATP-binding protein HmuV OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=hmuV PE=1 SV=2 835 1040 4.0E-08
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 836 1037 4.0E-08
sp|Q3J1N0|METN_RHOS4 Methionine import ATP-binding protein MetN OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=metN PE=3 SV=1 159 372 4.0E-08
sp|Q720M2|Y1216_LISMF Putative ABC transporter ATP-binding protein LMOf2365_1216 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=LMOf2365_1216 PE=3 SV=1 837 1037 5.0E-08
sp|Q66FK0|HMUV_YERPS Hemin import ATP-binding protein HmuV OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hmuV PE=3 SV=1 839 1040 5.0E-08
sp|Q1CE65|HMUV_YERPN Hemin import ATP-binding protein HmuV OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=hmuV PE=3 SV=1 839 1040 5.0E-08
sp|Q56993|HMUV_YERPE Hemin import ATP-binding protein HmuV OS=Yersinia pestis GN=hmuV PE=1 SV=1 839 1040 5.0E-08
sp|Q1C0Q8|HMUV_YERPA Hemin import ATP-binding protein HmuV OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=hmuV PE=3 SV=1 839 1040 5.0E-08
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 835 1040 5.0E-08
sp|Q92WD6|UGPC_RHIME sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium meliloti (strain 1021) GN=ugpC PE=3 SV=1 850 1044 5.0E-08
sp|Q92CK1|Y1170_LISIN Putative ABC transporter ATP-binding protein lin1170 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin1170 PE=3 SV=1 837 1037 5.0E-08
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 840 1037 5.0E-08
sp|Q38WL5|METN_LACSS Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1 159 391 6.0E-08
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 167 363 6.0E-08
sp|Q0SBZ1|FBPC1_RHOJR Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhodococcus jostii (strain RHA1) GN=fbpC1 PE=3 SV=1 850 1057 6.0E-08
sp|Q98HF7|POTA_RHILO Spermidine/putrescine import ATP-binding protein PotA OS=Rhizobium loti (strain MAFF303099) GN=potA PE=3 SV=1 831 1037 6.0E-08
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 144 362 6.0E-08
sp|Q67JX4|ECFA2_SYMTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ecfA2 PE=3 SV=1 838 1044 6.0E-08
sp|Q9STT6|AB6A_ARATH ABC transporter A family member 6 OS=Arabidopsis thaliana GN=ABCA6 PE=3 SV=2 850 1031 6.0E-08
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 144 362 7.0E-08
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 835 1037 7.0E-08
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 848 1044 7.0E-08
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 144 362 7.0E-08
sp|Q3KBH4|POTA_PSEPF Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf0-1) GN=potA PE=3 SV=1 851 1037 7.0E-08
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 836 1018 7.0E-08
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 850 1054 7.0E-08
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 149 368 8.0E-08
sp|Q1LQF6|METN_CUPMC Methionine import ATP-binding protein MetN OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=metN PE=3 SV=1 143 372 8.0E-08
sp|Q5MZ53|CMPD_SYNP6 Bicarbonate transport ATP-binding protein CmpD OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cmpD PE=3 SV=1 835 1037 8.0E-08
sp|Q55108|CMPD_SYNE7 Bicarbonate transport ATP-binding protein CmpD OS=Synechococcus elongatus (strain PCC 7942) GN=cmpD PE=1 SV=1 835 1037 8.0E-08
sp|Q8UII7|UGPC1_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC1 PE=3 SV=1 835 1044 8.0E-08
sp|Q3KK97|METN1_PSEPF Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=metN1 PE=3 SV=1 169 372 8.0E-08
sp|Q92XW1|CYSA1_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Rhizobium meliloti (strain 1021) GN=cysA1 PE=3 SV=1 169 362 8.0E-08
sp|Q74DN5|Y1281_GEOSL Putative ABC transporter ATP-binding protein GSU1281 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU1281 PE=3 SV=1 143 372 8.0E-08
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 838 1037 8.0E-08
sp|Q1M360|RBSA3_RHIL3 Ribose import ATP-binding protein RbsA 3 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rbsA3 PE=3 SV=1 835 1054 8.0E-08
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 833 1037 9.0E-08
sp|A0B3Z7|ARAG2_BURCH Arabinose import ATP-binding protein AraG 2 OS=Burkholderia cenocepacia (strain HI2424) GN=araG2 PE=3 SV=1 811 1046 9.0E-08
sp|Q1BJW2|ARAG2_BURCA Arabinose import ATP-binding protein AraG 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=araG2 PE=3 SV=1 811 1046 9.0E-08
sp|Q63S19|METN1_BURPS Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain K96243) GN=metN1 PE=3 SV=1 169 372 9.0E-08
sp|Q3JPZ4|METN1_BURP1 Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain 1710b) GN=metN1 PE=3 SV=1 169 372 9.0E-08
sp|Q62M41|METN1_BURMA Methionine import ATP-binding protein MetN 1 OS=Burkholderia mallei (strain ATCC 23344) GN=metN1 PE=3 SV=1 169 372 9.0E-08
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 141 368 9.0E-08
sp|Q6MPX9|MACB_BDEBA Macrolide export ATP-binding/permease protein MacB OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=macB PE=3 SV=1 850 1037 9.0E-08
sp|Q832R5|Y2153_ENTFA Putative ABC transporter ATP-binding protein EF_2153 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=EF_2153 PE=3 SV=1 837 1018 9.0E-08
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 847 1044 9.0E-08
sp|Q15TB1|LOLD_PSEA6 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=lolD PE=3 SV=1 833 1037 9.0E-08
sp|Q84K47|AB2A_ARATH ABC transporter A family member 2 OS=Arabidopsis thaliana GN=ABCA2 PE=2 SV=1 851 1037 9.0E-08
sp|Q0B5V4|ARAG2_BURCM Arabinose import ATP-binding protein AraG 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=araG2 PE=3 SV=1 811 1043 9.0E-08
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 151 372 1.0E-07
sp|Q8DZJ0|POTA_STRA5 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=potA PE=3 SV=1 839 1037 1.0E-07
sp|Q8E554|POTA_STRA3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=potA PE=3 SV=1 839 1037 1.0E-07
sp|Q3K0Y6|POTA_STRA1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=potA PE=3 SV=1 839 1037 1.0E-07
sp|Q48PU6|METN1_PSE14 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN1 PE=3 SV=1 169 372 1.0E-07
sp|Q2RZ08|HMUV_SALRD Hemin import ATP-binding protein HmuV OS=Salinibacter ruber (strain DSM 13855 / M31) GN=hmuV PE=3 SV=1 835 1038 1.0E-07
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 835 1037 1.0E-07
sp|Q87AL9|METN_XYLFT Methionine import ATP-binding protein MetN OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metN PE=3 SV=1 155 372 1.0E-07
sp|Q1GID1|UGPC_RUEST sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria sp. (strain TM1040) GN=ugpC PE=3 SV=1 835 1044 1.0E-07
sp|Q13ZJ1|NODI_BURXL Nod factor export ATP-binding protein I OS=Burkholderia xenovorans (strain LB400) GN=nodI PE=3 SV=1 835 1040 1.0E-07
sp|Q66AT7|ZNUC_YERPS Zinc import ATP-binding protein ZnuC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=znuC PE=3 SV=1 835 1018 1.0E-07
sp|Q01937|LACK_RHIRD Lactose transport ATP-binding protein LacK OS=Rhizobium radiobacter GN=lacK PE=3 SV=1 850 1037 1.0E-07
sp|Q2K3Y7|ARAG_RHIEC Arabinose import ATP-binding protein AraG OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=araG PE=3 SV=1 840 1037 1.0E-07
sp|Q1CJG3|ZNUC_YERPN Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=znuC PE=3 SV=1 835 1018 1.0E-07
sp|Q7CIC2|ZNUC_YERPE Zinc import ATP-binding protein ZnuC OS=Yersinia pestis GN=znuC PE=3 SV=1 835 1018 1.0E-07
sp|Q1C812|ZNUC_YERPA Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=znuC PE=3 SV=1 835 1018 1.0E-07
sp|Q5PDU4|CBIO_SALPA Cobalt import ATP-binding protein CbiO OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cbiO PE=3 SV=1 842 1042 1.0E-07
sp|Q0K1N8|PHNC2_CUPNH Phosphonates import ATP-binding protein PhnC 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phnC2 PE=3 SV=1 154 371 1.0E-07
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 166 363 2.0E-07
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 835 1038 2.0E-07
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 835 1038 2.0E-07
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 835 1038 2.0E-07
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 835 1038 2.0E-07
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 1105 1323 3.0E-07
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 159 363 3.0E-07
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 835 1037 3.0E-07
sp|A1K323|MACB_AZOSB Macrolide export ATP-binding/permease protein MacB OS=Azoarcus sp. (strain BH72) GN=macB PE=3 SV=1 141 379 3.0E-07
sp|Q55462|CMPC_SYNY3 Bicarbonate transport ATP-binding protein CmpC OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cmpC PE=2 SV=1 834 1037 3.0E-07
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 836 1040 4.0E-07
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 169 372 4.0E-07
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 169 372 4.0E-07
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 835 1037 5.0E-07
sp|O86751|FBPC_STRCO Fe(3+) ions import ATP-binding protein FbpC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fbpC PE=3 SV=1 170 368 6.0E-07
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 167 362 8.0E-07
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 461 627 1.0E-06
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 169 383 1.0E-06
sp|Q8TI15|Y4342_METAC Putative ABC transporter ATP-binding protein MA_4342 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4342 PE=3 SV=1 153 368 1.0E-06
sp|Q5P4W2|MODC_AROAE Molybdenum import ATP-binding protein ModC OS=Aromatoleum aromaticum (strain EbN1) GN=modC PE=3 SV=1 811 1047 1.0E-06
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 837 1021 1.0E-06
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 833 1037 1.0E-06
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 835 1038 1.0E-06
sp|Q93D97|Y1934_STRMU Putative ABC transporter ATP-binding protein SMU_1934c OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=sdcBA PE=3 SV=1 809 1037 1.0E-06
sp|Q3J1N0|METN_RHOS4 Methionine import ATP-binding protein MetN OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=metN PE=3 SV=1 807 1044 1.0E-06
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 835 1038 1.0E-06
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 835 1038 1.0E-06
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 847 1037 2.0E-06
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 835 1037 2.0E-06
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 839 1050 2.0E-06
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 840 1037 2.0E-06
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 148 368 3.0E-06
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 840 1085 4.0E-06
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 835 1037 4.0E-06
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 167 363 4.0E-06
sp|O85818|POTA_AGGAC Spermidine/putrescine import ATP-binding protein PotA OS=Aggregatibacter actinomycetemcomitans GN=potA PE=3 SV=1 142 368 4.0E-06
sp|Q6N9W0|METN1_RHOPA Methionine import ATP-binding protein MetN 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metN1 PE=3 SV=1 840 1044 4.0E-06
sp|P38045|NRTC_SYNE7 Nitrate transport ATP-binding protein NrtC OS=Synechococcus elongatus (strain PCC 7942) GN=nrtC PE=3 SV=1 159 368 5.0E-06
sp|Q92UV5|FBPC2_RHIME Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhizobium meliloti (strain 1021) GN=fbpC2 PE=3 SV=1 838 1038 5.0E-06
sp|Q2W1R8|MODC_MAGSA Molybdenum import ATP-binding protein ModC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=modC PE=3 SV=1 149 393 5.0E-06
sp|Q9TKX3|CYSA_NEPOL Sulfate/thiosulfate import ATP-binding protein CysA OS=Nephroselmis olivacea GN=cysA PE=3 SV=1 835 994 6.0E-06
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 169 372 6.0E-06
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 847 1018 7.0E-06
sp|Q8Y0X3|METN_RALSO Methionine import ATP-binding protein MetN OS=Ralstonia solanacearum (strain GMI1000) GN=metN PE=3 SV=1 831 1046 9.0E-06
sp|Q88DY1|HMUV_PSEPK Hemin import ATP-binding protein HmuV OS=Pseudomonas putida (strain KT2440) GN=hmuV PE=3 SV=1 149 371 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0042626 ATPase-coupled transmembrane transporter activity Yes
GO:0005524 ATP binding Yes
GO:0016020 membrane Yes
GO:0016021 integral component of membrane Yes
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0051179 localization No
GO:0006810 transport No
GO:0032555 purine ribonucleotide binding No
GO:0031224 intrinsic component of membrane No
GO:0140657 ATP-dependent activity No
GO:0022804 active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0000166 nucleotide binding No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 485 507 22
2 519 541 22
3 570 589 19
4 594 616 22
5 626 645 19
6 652 671 19
7 731 753 22
8 1155 1177 22
9 1187 1209 22
10 1239 1258 19
11 1268 1290 22
12 1303 1325 22
13 1421 1443 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3297
MPDHKPEQLQQKLECERESTWTERCRSYSDGPARRRQRKGVSVEQAVADFAELERELSVASRKERTKADVDVEKA
AIDDGASDDSVVLDLETVLRCGLDSGSRAKHIGLCWDGVTVRGIASETNYVRTLPDALVRLVDVVTPLMRLAGLC
RQPAETRLLRDLRGVCRPGEMVLVLGKPGAGCSTLLRVLANQRRGFTSVDGRVQYGPWSAADFGRRFRGEAVYNA
EDDAHLATLTVEQTLNFALELSMPTATAGLRRRVLDTLLAMFNMEHARTTAVGDAYVAGLSGGERRRVSIAEMML
TRACVLCWDNSTRGLDASTALDFVRSLRVQTDLYQTATLVSLYQASETIYRLFDRVLVLVQGRQAYFGPAADARA
YFERLGFAPSPRQTTADYLVACADGLEPDVLGEAFGRSEAAARLDADLAAYHRRDCTDEDGRRAFAAAVREAQRG
AAAARSTSYRAGFGLQVWALARRQFALKLQDRFNLTLSWMRSLVIAVVLGTLYRNLGRTSASAFSRGGLLFGALF
FNALQAFSELAGTMLGRAVVEKHRAYAFHRPSALWLAQMGVDQAFAATEILAFSIIVYLMTGLVRDPAAFFTFYL
LMLSGNVAMTLVFRIIGCLSRDFDVAIRFAVVVITLFVTTSGYMIQYEDEKPWLRWMSWVNVLGLIFGALMENEF
GRIDLGCAAESLIPAGPGYDDVRHQVCTLPGSRPGTLAVGGGDYIAQGFSYRPGDMWRNWGIVAAIIVALLVLNV
VLGELVRFDAARASARRSLRPNRERRALNEKLAAATKREANDDDDQDLYPLQDEEEVRREPFKGGVLTWDRLTYD
VPTTGGGGGGTRRLLSDMDGFLRPGELTALMGASGAGKTTLLDVLAARKTVGIVRGSVLLDGVPHSGGRSTAYAE
QLDLHEPTQTVREALRFSAHLRQPRGTPRAEREAYVEHVLAMLEMESLADCIIGTTEAGLSVEERKRVTIGVELA
ARPRAVLFLDEPTSGLDSRGALNTIRLLKKLAAAGQAVLCTIHQPDAALFALFDRLLLMRRGGRVVYFGDIGLDA
VVLRAYLARHGAADEAAPTDNVAEFMLEAISSSSSSSSSHGGDWADVWDESAERAAVVETVSRLRRDAVVHEKTD
GGSSGPTTTTRQLRVVTTRAFRCLWRSPDYVVTRILGQLAVALVSGLTYLGLDDSRASLQSTVFVMFQVTVVPAL
VISQVEVMFHGKRAIFFREAAAGMYSPAVFASAMAAAEIPISLLCGLVFFVCIYFAPGLSLEGSRAGYQFLMVVV
TELFAVTLGQAVAALTPSPRIAAQVDPLLITILALFCGVTIPAPQIPSFWRSWLYPLDPLTRLIGGMVTTALHGL
AVRCRPQELNRFTAPNGLSCGQYMEPFFARGGPGYLVRNDTSECEYCAFKLGDEFYEPLGLSFAYRWRDLSILAA
FVVSNVVILFSASRFLNFGKR
Coding >Ophio5|3297
ATGCCGGATCACAAGCCTGAGCAGTTACAACAAAAGTTGGAGTGCGAAAGGGAATCGACATGGACGGAGCGCTGT
CGGTCGTACAGTGACGGCCCGGCCCGGCGACGGCAGCGCAAGGGGGTCTCGGTGGAGCAGGCCGTGGCCGACTTT
GCAGAGCTCGAACGCGAGCTCAGCGTGGCCAGCCGCAAGGAGCGGACCAAGGCCGACGTCGACGTGGAAAAGGCG
GCGATAGACGATGGCGCCTCCGACGACAGCGTCGTCTTGGACCTCGAGACGGTCCTCCGCTGCGGCCTCGACTCC
GGCAGCCGGGCCAAGCACATCGGCCTGTGCTGGGACGGAGTGACGGTCCGGGGCATAGCCAGCGAGACCAACTAC
GTGCGGACGCTCCCCGACGCCCTCGTGCGGCTCGTCGACGTCGTGACGCCCTTGATGCGGCTCGCGGGCCTCTGC
AGGCAGCCGGCCGAAACGAGGCTGCTGCGCGACCTCCGGGGCGTGTGTCGGCCCGGCGAGATGGTGCTGGTCCTG
GGCAAGCCGGGCGCCGGCTGCTCGACGCTGCTCCGGGTCCTGGCCAACCAGCGGCGCGGCTTCACGTCCGTCGAC
GGCCGGGTCCAGTACGGGCCTTGGTCGGCAGCCGACTTTGGCCGACGGTTCCGCGGCGAGGCCGTGTACAACGCC
GAAGACGATGCCCATCTGGCGACGCTGACGGTGGAACAGACGCTGAACTTCGCCCTGGAGCTGTCGATGCCGACG
GCGACGGCCGGGCTGCGACGGCGGGTGCTCGACACGCTGTTGGCCATGTTCAACATGGAACACGCCCGGACGACG
GCCGTGGGGGATGCCTACGTTGCCGGTCTCTCGGGGGGCGAGCGGCGGCGCGTGTCCATCGCCGAGATGATGCTG
ACGCGTGCCTGTGTCCTGTGCTGGGACAACAGCACGCGTGGCCTCGACGCCAGCACCGCTCTCGACTTTGTGCGC
TCGCTGCGTGTGCAGACGGATCTGTATCAAACCGCCACCCTCGTCTCGCTTTACCAGGCTTCCGAGACCATCTAC
CGCCTCTTCGACCGCGTCCTGGTGCTCGTCCAAGGTCGTCAGGCTTACTTTGGCCCGGCCGCCGACGCCCGGGCC
TATTTTGAGCGTCTCGGCTTCGCTCCGAGTCCGCGGCAGACGACGGCCGACTACCTGGTCGCCTGCGCCGACGGT
CTGGAGCCGGACGTGCTGGGCGAGGCCTTTGGCCGGTCCGAGGCCGCCGCCCGTCTTGACGCCGACCTGGCCGCC
TACCACCGCCGTGACTGTACCGACGAGGATGGGCGACGGGCCTTTGCTGCCGCCGTACGCGAGGCCCAGCGCGGC
GCCGCCGCGGCCCGGTCTACCTCTTATCGGGCCGGCTTCGGGCTGCAGGTATGGGCGCTGGCGAGGCGACAGTTT
GCCCTGAAGCTGCAGGACCGGTTCAACCTGACGCTCTCGTGGATGCGGAGCCTCGTCATCGCCGTCGTCCTCGGC
ACGCTGTACCGCAACCTGGGCCGCACTTCGGCCAGCGCCTTCAGCCGAGGCGGACTGCTCTTTGGTGCCCTGTTC
TTCAACGCTCTCCAGGCCTTTTCCGAGCTGGCGGGCACGATGCTGGGCCGGGCCGTGGTGGAGAAGCATCGTGCC
TACGCCTTCCACCGGCCGTCGGCTCTTTGGCTGGCTCAGATGGGCGTGGATCAGGCGTTCGCCGCGACGGAGATT
CTGGCCTTTAGCATCATCGTCTATCTCATGACGGGACTCGTCCGAGACCCGGCCGCTTTCTTCACCTTTTACCTG
CTCATGCTGTCGGGCAACGTGGCCATGACGCTCGTCTTTCGCATCATCGGCTGCCTCAGCCGCGACTTCGACGTG
GCCATCCGCTTTGCCGTCGTCGTCATCACCCTCTTCGTCACCACGTCGGGATACATGATCCAGTACGAAGACGAG
AAGCCTTGGCTGCGGTGGATGTCGTGGGTCAACGTCTTGGGCCTCATCTTCGGCGCCCTGATGGAGAACGAGTTC
GGCCGGATCGACCTCGGCTGCGCCGCTGAATCGCTCATACCGGCGGGCCCGGGCTACGACGACGTGCGCCATCAG
GTCTGCACGCTGCCGGGGTCGAGGCCGGGGACGCTCGCCGTTGGGGGGGGTGACTACATCGCTCAGGGCTTCTCG
TACCGGCCCGGCGACATGTGGCGGAACTGGGGCATCGTCGCCGCCATCATCGTCGCCCTCCTTGTGCTCAACGTC
GTGCTGGGCGAGCTTGTGCGATTCGACGCCGCTCGCGCCTCTGCTCGTCGGTCCCTACGGCCCAACCGTGAGCGG
CGCGCCCTCAACGAGAAGCTGGCGGCGGCCACCAAGCGCGAGGCCAACGACGACGACGACCAAGACTTATACCCA
CTACAGGACGAGGAGGAAGTGCGTCGCGAGCCTTTCAAGGGCGGCGTCCTTACATGGGACCGACTCACGTACGAC
GTGCCAACGACTGGCGGCGGCGGCGGCGGCACACGACGACTGCTCTCCGACATGGACGGCTTCCTCCGGCCGGGC
GAGCTGACGGCGCTCATGGGCGCGTCCGGAGCGGGCAAGACGACGCTGCTGGACGTGCTGGCGGCGCGGAAGACG
GTCGGCATCGTCCGAGGCTCCGTCCTCCTCGACGGCGTCCCGCACTCGGGCGGACGGTCCACGGCCTACGCCGAG
CAGCTGGATCTCCACGAGCCGACGCAGACGGTGCGCGAGGCGCTACGCTTCTCAGCCCATCTACGACAGCCGCGA
GGGACGCCACGGGCCGAGCGGGAGGCCTACGTCGAGCACGTCCTCGCCATGCTGGAGATGGAATCCCTGGCCGAT
TGCATCATCGGCACGACCGAGGCCGGACTCAGCGTCGAGGAGCGCAAACGCGTCACCATCGGGGTCGAGCTGGCG
GCCCGGCCTCGAGCGGTGCTCTTCCTCGACGAGCCCACGTCGGGACTCGACAGCCGGGGCGCCCTCAACACCATC
CGGCTCCTCAAGAAGCTCGCCGCCGCCGGCCAGGCCGTTCTCTGCACCATCCACCAGCCCGACGCCGCCCTCTTC
GCCCTCTTCGACCGGCTGCTGCTGATGCGTCGAGGCGGGCGCGTCGTCTACTTTGGAGACATTGGCCTCGACGCC
GTCGTCTTGAGAGCCTATCTTGCCAGACACGGGGCGGCTGATGAGGCGGCGCCGACGGACAACGTGGCCGAGTTC
ATGCTCGAGGCCATCAGCAGCAGCAGCAGCAGCAGCAGCAGTCATGGTGGCGACTGGGCCGACGTCTGGGACGAG
AGCGCCGAGCGAGCGGCCGTGGTGGAGACGGTGTCCCGTCTACGGAGGGACGCGGTCGTACACGAGAAGACGGAT
GGCGGGTCGTCCGGACCGACGACGACGACGCGGCAGCTTCGGGTGGTGACGACGAGGGCCTTTCGTTGCCTCTGG
CGCTCGCCCGACTACGTCGTCACCCGCATCCTGGGCCAGTTGGCGGTGGCGCTGGTCAGCGGGCTGACGTACCTC
GGACTGGACGACTCGCGGGCGTCGTTGCAGAGCACCGTCTTCGTCATGTTCCAGGTCACGGTGGTGCCGGCCCTG
GTCATCAGCCAGGTGGAAGTCATGTTCCACGGCAAACGAGCCATCTTCTTCCGCGAGGCGGCGGCCGGCATGTAC
TCGCCCGCCGTCTTCGCCTCCGCCATGGCGGCGGCCGAGATTCCCATCTCCCTGCTCTGCGGCCTCGTCTTCTTC
GTCTGCATCTACTTCGCCCCGGGACTGTCGCTGGAAGGGTCTCGAGCCGGGTACCAATTCCTGATGGTGGTGGTG
ACGGAGCTTTTCGCCGTCACGCTCGGACAGGCCGTCGCCGCCTTGACGCCTTCGCCTCGGATCGCGGCCCAGGTC
GATCCGCTACTCATCACCATCCTCGCCCTCTTCTGCGGCGTCACCATACCCGCGCCTCAGATCCCTTCCTTCTGG
CGCTCTTGGCTCTACCCGCTCGACCCGCTCACGAGGCTCATCGGCGGCATGGTGACGACGGCGCTTCACGGCCTC
GCCGTCCGCTGTCGGCCCCAAGAGCTCAACCGCTTCACGGCCCCGAACGGCCTCAGCTGCGGCCAGTACATGGAA
CCCTTTTTCGCCCGTGGCGGGCCCGGTTATCTCGTCAGAAACGACACGTCGGAATGCGAGTATTGCGCTTTCAAG
CTGGGCGATGAGTTTTACGAGCCTTTGGGCTTGTCCTTTGCCTACCGCTGGCGCGATTTGTCCATTCTTGCGGCC
TTTGTCGTGAGCAATGTCGTCATTCTCTTTTCTGCCAGTCGATTTCTCAACTTTGGCAAGAGA
Transcript >Ophio5|3297
ATGCCGGATCACAAGCCTGAGCAGTTACAACAAAAGTTGGAGTGCGAAAGGGAATCGACATGGACGGAGCGCTGT
CGGTCGTACAGTGACGGCCCGGCCCGGCGACGGCAGCGCAAGGGGGTCTCGGTGGAGCAGGCCGTGGCCGACTTT
GCAGAGCTCGAACGCGAGCTCAGCGTGGCCAGCCGCAAGGAGCGGACCAAGGCCGACGTCGACGTGGAAAAGGCG
GCGATAGACGATGGCGCCTCCGACGACAGCGTCGTCTTGGACCTCGAGACGGTCCTCCGCTGCGGCCTCGACTCC
GGCAGCCGGGCCAAGCACATCGGCCTGTGCTGGGACGGAGTGACGGTCCGGGGCATAGCCAGCGAGACCAACTAC
GTGCGGACGCTCCCCGACGCCCTCGTGCGGCTCGTCGACGTCGTGACGCCCTTGATGCGGCTCGCGGGCCTCTGC
AGGCAGCCGGCCGAAACGAGGCTGCTGCGCGACCTCCGGGGCGTGTGTCGGCCCGGCGAGATGGTGCTGGTCCTG
GGCAAGCCGGGCGCCGGCTGCTCGACGCTGCTCCGGGTCCTGGCCAACCAGCGGCGCGGCTTCACGTCCGTCGAC
GGCCGGGTCCAGTACGGGCCTTGGTCGGCAGCCGACTTTGGCCGACGGTTCCGCGGCGAGGCCGTGTACAACGCC
GAAGACGATGCCCATCTGGCGACGCTGACGGTGGAACAGACGCTGAACTTCGCCCTGGAGCTGTCGATGCCGACG
GCGACGGCCGGGCTGCGACGGCGGGTGCTCGACACGCTGTTGGCCATGTTCAACATGGAACACGCCCGGACGACG
GCCGTGGGGGATGCCTACGTTGCCGGTCTCTCGGGGGGCGAGCGGCGGCGCGTGTCCATCGCCGAGATGATGCTG
ACGCGTGCCTGTGTCCTGTGCTGGGACAACAGCACGCGTGGCCTCGACGCCAGCACCGCTCTCGACTTTGTGCGC
TCGCTGCGTGTGCAGACGGATCTGTATCAAACCGCCACCCTCGTCTCGCTTTACCAGGCTTCCGAGACCATCTAC
CGCCTCTTCGACCGCGTCCTGGTGCTCGTCCAAGGTCGTCAGGCTTACTTTGGCCCGGCCGCCGACGCCCGGGCC
TATTTTGAGCGTCTCGGCTTCGCTCCGAGTCCGCGGCAGACGACGGCCGACTACCTGGTCGCCTGCGCCGACGGT
CTGGAGCCGGACGTGCTGGGCGAGGCCTTTGGCCGGTCCGAGGCCGCCGCCCGTCTTGACGCCGACCTGGCCGCC
TACCACCGCCGTGACTGTACCGACGAGGATGGGCGACGGGCCTTTGCTGCCGCCGTACGCGAGGCCCAGCGCGGC
GCCGCCGCGGCCCGGTCTACCTCTTATCGGGCCGGCTTCGGGCTGCAGGTATGGGCGCTGGCGAGGCGACAGTTT
GCCCTGAAGCTGCAGGACCGGTTCAACCTGACGCTCTCGTGGATGCGGAGCCTCGTCATCGCCGTCGTCCTCGGC
ACGCTGTACCGCAACCTGGGCCGCACTTCGGCCAGCGCCTTCAGCCGAGGCGGACTGCTCTTTGGTGCCCTGTTC
TTCAACGCTCTCCAGGCCTTTTCCGAGCTGGCGGGCACGATGCTGGGCCGGGCCGTGGTGGAGAAGCATCGTGCC
TACGCCTTCCACCGGCCGTCGGCTCTTTGGCTGGCTCAGATGGGCGTGGATCAGGCGTTCGCCGCGACGGAGATT
CTGGCCTTTAGCATCATCGTCTATCTCATGACGGGACTCGTCCGAGACCCGGCCGCTTTCTTCACCTTTTACCTG
CTCATGCTGTCGGGCAACGTGGCCATGACGCTCGTCTTTCGCATCATCGGCTGCCTCAGCCGCGACTTCGACGTG
GCCATCCGCTTTGCCGTCGTCGTCATCACCCTCTTCGTCACCACGTCGGGATACATGATCCAGTACGAAGACGAG
AAGCCTTGGCTGCGGTGGATGTCGTGGGTCAACGTCTTGGGCCTCATCTTCGGCGCCCTGATGGAGAACGAGTTC
GGCCGGATCGACCTCGGCTGCGCCGCTGAATCGCTCATACCGGCGGGCCCGGGCTACGACGACGTGCGCCATCAG
GTCTGCACGCTGCCGGGGTCGAGGCCGGGGACGCTCGCCGTTGGGGGGGGTGACTACATCGCTCAGGGCTTCTCG
TACCGGCCCGGCGACATGTGGCGGAACTGGGGCATCGTCGCCGCCATCATCGTCGCCCTCCTTGTGCTCAACGTC
GTGCTGGGCGAGCTTGTGCGATTCGACGCCGCTCGCGCCTCTGCTCGTCGGTCCCTACGGCCCAACCGTGAGCGG
CGCGCCCTCAACGAGAAGCTGGCGGCGGCCACCAAGCGCGAGGCCAACGACGACGACGACCAAGACTTATACCCA
CTACAGGACGAGGAGGAAGTGCGTCGCGAGCCTTTCAAGGGCGGCGTCCTTACATGGGACCGACTCACGTACGAC
GTGCCAACGACTGGCGGCGGCGGCGGCGGCACACGACGACTGCTCTCCGACATGGACGGCTTCCTCCGGCCGGGC
GAGCTGACGGCGCTCATGGGCGCGTCCGGAGCGGGCAAGACGACGCTGCTGGACGTGCTGGCGGCGCGGAAGACG
GTCGGCATCGTCCGAGGCTCCGTCCTCCTCGACGGCGTCCCGCACTCGGGCGGACGGTCCACGGCCTACGCCGAG
CAGCTGGATCTCCACGAGCCGACGCAGACGGTGCGCGAGGCGCTACGCTTCTCAGCCCATCTACGACAGCCGCGA
GGGACGCCACGGGCCGAGCGGGAGGCCTACGTCGAGCACGTCCTCGCCATGCTGGAGATGGAATCCCTGGCCGAT
TGCATCATCGGCACGACCGAGGCCGGACTCAGCGTCGAGGAGCGCAAACGCGTCACCATCGGGGTCGAGCTGGCG
GCCCGGCCTCGAGCGGTGCTCTTCCTCGACGAGCCCACGTCGGGACTCGACAGCCGGGGCGCCCTCAACACCATC
CGGCTCCTCAAGAAGCTCGCCGCCGCCGGCCAGGCCGTTCTCTGCACCATCCACCAGCCCGACGCCGCCCTCTTC
GCCCTCTTCGACCGGCTGCTGCTGATGCGTCGAGGCGGGCGCGTCGTCTACTTTGGAGACATTGGCCTCGACGCC
GTCGTCTTGAGAGCCTATCTTGCCAGACACGGGGCGGCTGATGAGGCGGCGCCGACGGACAACGTGGCCGAGTTC
ATGCTCGAGGCCATCAGCAGCAGCAGCAGCAGCAGCAGCAGTCATGGTGGCGACTGGGCCGACGTCTGGGACGAG
AGCGCCGAGCGAGCGGCCGTGGTGGAGACGGTGTCCCGTCTACGGAGGGACGCGGTCGTACACGAGAAGACGGAT
GGCGGGTCGTCCGGACCGACGACGACGACGCGGCAGCTTCGGGTGGTGACGACGAGGGCCTTTCGTTGCCTCTGG
CGCTCGCCCGACTACGTCGTCACCCGCATCCTGGGCCAGTTGGCGGTGGCGCTGGTCAGCGGGCTGACGTACCTC
GGACTGGACGACTCGCGGGCGTCGTTGCAGAGCACCGTCTTCGTCATGTTCCAGGTCACGGTGGTGCCGGCCCTG
GTCATCAGCCAGGTGGAAGTCATGTTCCACGGCAAACGAGCCATCTTCTTCCGCGAGGCGGCGGCCGGCATGTAC
TCGCCCGCCGTCTTCGCCTCCGCCATGGCGGCGGCCGAGATTCCCATCTCCCTGCTCTGCGGCCTCGTCTTCTTC
GTCTGCATCTACTTCGCCCCGGGACTGTCGCTGGAAGGGTCTCGAGCCGGGTACCAATTCCTGATGGTGGTGGTG
ACGGAGCTTTTCGCCGTCACGCTCGGACAGGCCGTCGCCGCCTTGACGCCTTCGCCTCGGATCGCGGCCCAGGTC
GATCCGCTACTCATCACCATCCTCGCCCTCTTCTGCGGCGTCACCATACCCGCGCCTCAGATCCCTTCCTTCTGG
CGCTCTTGGCTCTACCCGCTCGACCCGCTCACGAGGCTCATCGGCGGCATGGTGACGACGGCGCTTCACGGCCTC
GCCGTCCGCTGTCGGCCCCAAGAGCTCAACCGCTTCACGGCCCCGAACGGCCTCAGCTGCGGCCAGTACATGGAA
CCCTTTTTCGCCCGTGGCGGGCCCGGTTATCTCGTCAGAAACGACACGTCGGAATGCGAGTATTGCGCTTTCAAG
CTGGGCGATGAGTTTTACGAGCCTTTGGGCTTGTCCTTTGCCTACCGCTGGCGCGATTTGTCCATTCTTGCGGCC
TTTGTCGTGAGCAATGTCGTCATTCTCTTTTCTGCCAGTCGATTTCTCAACTTTGGCAAGAGATGA
Gene >Ophio5|3297
ATGCCGGATCACAAGCCTGAGCAGTTACAACAAAAGTTGGAGTGCGAAAGGGAATCGACATGGACGGAGCGCTGT
CGGTCGTACAGTGACGGCCCGGCCCGGCGACGGCAGCGCAAGGGGGTCTCGGTGGAGCAGGCCGTGGCCGACTTT
GCAGAGCTCGAACGCGAGCTCAGCGTGGCCAGCCGCAAGGAGCGGACCAAGGCCGACGTCGACGTGGAAAAGGCG
GCGATAGACGATGGCGCCTCCGACGACAGCGTCGTCTTGGACCTCGAGACGGTCCTCCGCTGCGGCCTCGACTCC
GGCAGCCGGGCCAAGCACATCGGCCTGTGCTGGGACGGAGTGACGGTCCGGGGCATAGCCAGCGAGACCAACTAC
GTGCGGACGCTCCCCGACGCCCTCGTGCGGCTCGTCGACGTCGTGACGCCCTTGATGCGGCTCGCGGGCCTCTGC
AGGCAGCCGGCCGAAACGAGGCTGCTGCGCGACCTCCGGGGCGTGTGTCGGCCCGGCGAGATGGTGCTGGTCCTG
GGCAAGCCGGGCGCCGGCTGCTCGACGCTGCTCCGGGTCCTGGCCAACCAGCGGCGCGGCTTCACGTCCGTCGAC
GGCCGGGTCCAGTACGGGCCTTGGTCGGCAGCCGACTTTGGCCGACGGTTCCGCGGCGAGGCCGTGTACAACGCC
GAAGACGATGCCCATCTGGCGACGCTGACGGTGGAACAGACGCTGAACTTCGCCCTGGAGCTGTCGATGCCGACG
GCGACGGCCGGGCTGCGACGGCGGGTGCTCGACACGCTGTTGGCCATGTTCAACATGGAACACGCCCGGACGACG
GCCGTGGGGGATGCCTACGTTGCCGGTCTCTCGGGGGGCGAGCGGCGGCGCGTGTCCATCGCCGAGATGATGCTG
ACGCGTGCCTGTGTCCTGTGCTGGGACAACAGCACGCGTGGCCTCGACGCCAGCACCGCTCTCGACTTTGTGCGC
TCGCTGCGTGTGCAGACGGATCTGTATCAAACCGCCACCCTCGTCTCGCTTTACCAGGCTTCCGAGACCATCTAC
CGCCTCTTCGACCGCGTCCTGGTGCTCGTCCAAGGTCGTCAGGCTTACTTTGGCCCGGCCGCCGACGCCCGGGCC
TATTTTGAGCGTCTCGGCTTCGCTCCGAGTCCGCGGCAGACGACGGCCGACTACCTGGTCGCCTGCGCCGACGGT
CTGGAGCCGGACGTGCTGGGCGAGGCCTTTGGCCGGTCCGAGGCCGCCGCCCGTCTTGACGCCGACCTGGCCGCC
TACCACCGCCGTGACTGTACCGACGAGGATGGGCGACGGGCCTTTGCTGCCGCCGTACGCGAGGCCCAGCGCGGC
GCCGCCGCGGCCCGGTCTACCTCTTATCGGGCCGGCTTCGGGCTGCAGGTATGGGCGCTGGCGAGGCGACAGTTT
GCCCTGAAGCTGCAGGACCGGTTCAACCTGACGCTCTCGTGGATGCGGAGCCTCGTCATCGCCGTCGTCCTCGGC
ACGCTGTACCGCAACCTGGGCCGCACTTCGGCCAGCGCCTTCAGCCGAGGCGGACTGCTCTTTGGTGCCCTGTTC
TTCAACGCTCTCCAGGCCTTTTCCGAGCTGGCGGGCACGATGCTGGGCCGGGCCGTGGTGGAGAAGCATCGTGCC
TACGCCTTCCACCGGCCGTCGGCTCTTTGGCTGGCTCAGATGGGCGTGGATCAGGCGTTCGCCGCGACGGAGATT
CTGGCCTTTAGCATCATCGTCTATCTCATGACGGGACTCGTCCGAGACCCGGCCGCTTTCTTCACCTTTTACCTG
CTCATGCTGTCGGGCAACGTGGCCATGACGCTCGTCTTTCGCATCATCGGCTGCCTCAGCCGCGACTTCGACGTG
GCCATCCGCTTTGCCGTCGTCGTCATCACCCTCTTCGTCACCACGTCGGGATACATGATCCAGTACGAAGACGAG
AAGCCTTGGCTGCGGTGGATGTCGTGGGTCAACGTCTTGGGCCTCATCTTCGGCGCCCTGATGGAGAACGAGTTC
GGCCGGATCGACCTCGGCTGCGCCGCTGAATCGCTCATACCGGCGGGCCCGGGCTACGACGACGTGCGCCATCAG
GTCTGCACGCTGCCGGGGTCGAGGCCGGGGACGCTCGCCGTTGGGGGGGGTGACTACATCGCTCAGGGCTTCTCG
TACCGGCCCGGCGACATGTGGCGGAACTGGGGCATCGTCGCCGCCATCATCGTCGCCCTCCTTGTGCTCAACGTC
GTGCTGGGCGAGCTTGTGCGATTCGACGCCGCTCGCGCCTCTGCTCGTCGGTCCCTACGGCCCAACCGTGAGCGG
CGCGCCCTCAACGAGAAGCTGGCGGCGGCCACCAAGCGCGAGGCCAACGACGACGACGACCAAGACTTATACCCA
CTACAGGACGAGGAGGAAGTGCGTCGCGAGCCTTTCAAGGGCGGCGTCCTTACATGGGACCGACTCACGTACGAC
GTGCCAACGACTGGCGGCGGCGGCGGCGGCACACGACGACTGCTCTCCGACATGGACGGCTTCCTCCGGCCGGGC
GAGCTGACGGCGCTCATGGGCGCGTCCGGAGCGGGCAAGACGACGCTGCTGGACGTGCTGGCGGCGCGGAAGACG
GTCGGCATCGTCCGAGGCTCCGTCCTCCTCGACGGCGTCCCGCACTCGGGCGGACGGTCCACGGCCTACGCCGAG
CAGCTGGATCTCCACGAGCCGACGCAGACGGTGCGCGAGGCGCTACGCTTCTCAGCCCATCTACGACAGCCGCGA
GGGACGCCACGGGCCGAGCGGGAGGCCTACGTCGAGCACGTCCTCGCCATGCTGGAGATGGAATCCCTGGCCGAT
TGCATCATCGGCACGACCGAGGCCGGACTCAGCGTCGAGGAGCGCAAACGCGTCACCATCGGGGTCGAGCTGGCG
GCCCGGCCTCGAGCGGTGCTCTTCCTCGACGAGCCCACGTCGGGACTCGACAGCCGGGGCGCCCTCAACACCATC
CGGCTCCTCAAGAAGCTCGCCGCCGCCGGCCAGGCCGTTCTCTGCACCATCCACCAGCCCGACGCCGCCCTCTTC
GCCCTCTTCGACCGGCTGCTGCTGATGCGTCGAGGCGGGCGCGTCGTCTACTTTGGAGACATTGGCCTCGACGCC
GTCGTCTTGAGAGCCTATCTTGCCAGACACGGGGCGGCTGATGAGGCGGCGCCGACGGACAACGTGGCCGAGTTC
ATGCTCGAGGCCATCAGCAGCAGCAGCAGCAGCAGCAGCAGTCATGGTGGCGACTGGGCCGACGTCTGGGACGAG
AGCGCCGAGCGAGCGGCCGTGGTGGAGACGGTGTCCCGTCTACGGAGGGACGCGGTCGTACACGAGAAGACGGAT
GGCGGGTCGTCCGGACCGACGACGACGACGCGGCAGCTTCGGGTGGTGACGACGAGGGCCTTTCGTTGCCTCTGG
CGCTCGCCCGACTACGTCGTCACCCGCATCCTGGGCCAGTTGGCGGTGGCGCTGGTCAGCGGGCTGACGTACCTC
GGACTGGACGACTCGCGGGCGTCGTTGCAGAGCACCGTCTTCGTCATGTTCCAGGTCACGGTGGTGCCGGCCCTG
GTCATCAGCCAGGTGGAAGTCATGTTCCACGGCAAACGAGCCATCTTCTTCCGCGAGGCGGCGGCCGGCATGTAC
TCGCCCGCCGTCTTCGCCTCCGCCATGGCGGCGGCCGAGATTCCCATCTCCCTGCTCTGCGGCCTCGTCTTCTTC
GTCTGCATCTACTTCGCCCCGGGACTGTCGCTGGAAGGGTCTCGAGCCGGGTACCAATTCCTGATGGTGGTGGTG
ACGGAGCTTTTCGCCGTCACGCTCGGACAGGCCGTCGCCGCCTTGACGCCTTCGCCTCGGATCGCGGCCCAGGTC
GATCCGCTACTCATCACCATCCTCGCCCTCTTCTGCGGCGTCACCATACCCGCGCCTCAGATCCCTTCCTTCTGG
CGCTCTTGGCTCTACCCGCTCGACCCGCTCACGAGGCTCATCGGCGGCATGGTGACGACGGCGCTTCACGGCCTC
GCCGTCCGCTGTCGGCCCCAAGAGCTCAACCGCTTCACGGCCCCGAACGGCCTCAGCTGCGGCCAGTACATGGAA
CCCTTTTTCGCCCGTGGCGGGCCCGGTTATCTCGTCAGAAACGACACGTCGGAATGCGAGTATTGCGCTTTCAAG
CTGGGCGATGAGTTTTACGAGCCTTTGGGCTTGTCCTTTGCCTACCGCTGGCGCGATTTGTCCATTCTTGCGGCC
TTTGTCGTGAGCAATGTCGTCATTCTCTTTTCTGCCGTGAGCTTCTCCTTTTCCCCTTCTTTCCTCCCCCCCTTC
CCCCTTCTTTCCTCCCCCCCTTTTTTTTTCATTTTTTTTGAAGTCTTTTGTGGCTGACGGGACGAATTCAAAGAG
TCGATTTCTCAACTTTGGCAAGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail