Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3284
Gene name
Locationscaffold_26:58828..60253
Strand-
Gene length (bp)1425
Transcript length (bp)1425
Coding sequence length (bp)1422
Protein length (aa) 474

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 11833.50 0.00 24880.50
CcL In ants, during behavior modification 3.88 0.90 6.86
CcD In ants, recently dead 3.33 0.69 5.97

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.734878 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3284
MYRISMAAGALVALQGAWAQQPSQTDVYPAEHTEEVKGYEGQYVDACSPVGTVRFNSTFPPCLSASRIEPSCALP
WKEGLSDEQRQGDWKAERKCLCDGSFFDDAGDGCLKCKGAYRIDSEENLAVWKGIWDKVRGSYCQDETLTGNFSS
YFKAASDQSSFQPVKDLGTKPAAGSIPIEAYYKNDKQGPGPLPGSTSSNSTAQDEAGPMEGVAQLTPDCRTMIGA
IDTLPGGNSAKFSNSSSGAILVSVQATFNRICIINGDQREVKAERKEEPVVTPISQEVVPKEKAAEKADFDMTGC
SCAQKVVPEGKQVVQSKESVEAWAMVSVMTGFAMVGGQLPQGCEGAQCGAQGGADAGASAGSEASSSASGNVYSV
DSVMGTFGGSAGGSAPASGGKSAVKAPAFVVKPGVQVSAKAQCGADGSCGQSKGSYGQKTEGASDGKPQCADGSC
GQPQGSAEGQTAPKSGNEDEIDYC
Coding >Ophio5|3284
ATGTATAGAATTTCGATGGCAGCCGGCGCCCTCGTGGCACTGCAGGGAGCCTGGGCCCAGCAGCCCTCTCAGACC
GATGTCTATCCTGCCGAGCACACGGAAGAGGTCAAGGGTTACGAGGGACAATATGTGGATGCCTGCTCGCCGGTT
GGCACCGTTCGATTCAACTCGACTTTCCCGCCTTGCCTGAGCGCTAGCAGGATCGAGCCCAGCTGTGCTCTTCCT
TGGAAGGAGGGTCTGTCGGATGAGCAGCGTCAGGGAGATTGGAAGGCGGAGAGGAAGTGTCTCTGCGACGGTAGC
TTCTTTGATGATGCTGGTGATGGGTGCCTCAAGTGCAAGGGGGCTTACCGTATCGACAGCGAGGAGAACCTTGCA
GTCTGGAAGGGCATTTGGGACAAGGTCCGTGGCAGCTACTGCCAGGATGAGACCCTGACGGGTAACTTCTCGTCG
TACTTCAAAGCAGCCTCAGACCAGTCTTCGTTCCAACCGGTCAAGGACCTTGGCACGAAGCCCGCAGCCGGAAGC
ATCCCGATCGAGGCCTACTACAAGAACGACAAGCAGGGCCCGGGCCCTCTCCCCGGCTCTACGTCCTCCAACTCG
ACCGCCCAGGACGAAGCCGGACCAATGGAGGGCGTCGCGCAGCTCACGCCCGACTGCCGCACCATGATTGGCGCC
ATCGATACGCTTCCGGGCGGCAACAGTGCCAAGTTTTCCAACTCGAGCTCGGGGGCCATTCTCGTCTCTGTGCAG
GCGACTTTCAACCGCATCTGCATCATCAACGGTGACCAGCGTGAAGTCAAGGCTGAGCGCAAGGAAGAGCCCGTT
GTTACGCCCATTTCGCAGGAGGTCGTGCCCAAGGAAAAGGCTGCGGAGAAGGCTGATTTCGATATGACGGGTTGC
TCGTGCGCTCAGAAGGTTGTTCCTGAGGGTAAGCAGGTTGTCCAGTCGAAGGAGTCCGTCGAGGCTTGGGCTATG
GTCTCTGTCATGACTGGATTCGCCATGGTTGGTGGACAGCTGCCGCAGGGCTGTGAGGGTGCTCAGTGCGGCGCT
CAGGGCGGTGCTGATGCCGGTGCTTCTGCTGGCAGTGAGGCATCATCTTCTGCCTCCGGCAACGTCTACTCCGTC
GACTCCGTCATGGGCACCTTCGGCGGATCGGCTGGTGGTTCGGCCCCTGCCTCTGGCGGCAAGTCTGCCGTCAAG
GCTCCGGCCTTTGTTGTGAAGCCTGGCGTCCAGGTCTCTGCCAAAGCCCAGTGTGGCGCTGACGGCTCTTGCGGA
CAGTCAAAGGGCTCCTATGGCCAAAAGACTGAGGGCGCCTCTGACGGAAAGCCCCAGTGCGCCGACGGCTCTTGC
GGACAGCCTCAGGGTTCTGCTGAGGGCCAGACGGCGCCGAAGTCGGGCAACGAGGATGAGATCGACTACTGC
Transcript >Ophio5|3284
ATGTATAGAATTTCGATGGCAGCCGGCGCCCTCGTGGCACTGCAGGGAGCCTGGGCCCAGCAGCCCTCTCAGACC
GATGTCTATCCTGCCGAGCACACGGAAGAGGTCAAGGGTTACGAGGGACAATATGTGGATGCCTGCTCGCCGGTT
GGCACCGTTCGATTCAACTCGACTTTCCCGCCTTGCCTGAGCGCTAGCAGGATCGAGCCCAGCTGTGCTCTTCCT
TGGAAGGAGGGTCTGTCGGATGAGCAGCGTCAGGGAGATTGGAAGGCGGAGAGGAAGTGTCTCTGCGACGGTAGC
TTCTTTGATGATGCTGGTGATGGGTGCCTCAAGTGCAAGGGGGCTTACCGTATCGACAGCGAGGAGAACCTTGCA
GTCTGGAAGGGCATTTGGGACAAGGTCCGTGGCAGCTACTGCCAGGATGAGACCCTGACGGGTAACTTCTCGTCG
TACTTCAAAGCAGCCTCAGACCAGTCTTCGTTCCAACCGGTCAAGGACCTTGGCACGAAGCCCGCAGCCGGAAGC
ATCCCGATCGAGGCCTACTACAAGAACGACAAGCAGGGCCCGGGCCCTCTCCCCGGCTCTACGTCCTCCAACTCG
ACCGCCCAGGACGAAGCCGGACCAATGGAGGGCGTCGCGCAGCTCACGCCCGACTGCCGCACCATGATTGGCGCC
ATCGATACGCTTCCGGGCGGCAACAGTGCCAAGTTTTCCAACTCGAGCTCGGGGGCCATTCTCGTCTCTGTGCAG
GCGACTTTCAACCGCATCTGCATCATCAACGGTGACCAGCGTGAAGTCAAGGCTGAGCGCAAGGAAGAGCCCGTT
GTTACGCCCATTTCGCAGGAGGTCGTGCCCAAGGAAAAGGCTGCGGAGAAGGCTGATTTCGATATGACGGGTTGC
TCGTGCGCTCAGAAGGTTGTTCCTGAGGGTAAGCAGGTTGTCCAGTCGAAGGAGTCCGTCGAGGCTTGGGCTATG
GTCTCTGTCATGACTGGATTCGCCATGGTTGGTGGACAGCTGCCGCAGGGCTGTGAGGGTGCTCAGTGCGGCGCT
CAGGGCGGTGCTGATGCCGGTGCTTCTGCTGGCAGTGAGGCATCATCTTCTGCCTCCGGCAACGTCTACTCCGTC
GACTCCGTCATGGGCACCTTCGGCGGATCGGCTGGTGGTTCGGCCCCTGCCTCTGGCGGCAAGTCTGCCGTCAAG
GCTCCGGCCTTTGTTGTGAAGCCTGGCGTCCAGGTCTCTGCCAAAGCCCAGTGTGGCGCTGACGGCTCTTGCGGA
CAGTCAAAGGGCTCCTATGGCCAAAAGACTGAGGGCGCCTCTGACGGAAAGCCCCAGTGCGCCGACGGCTCTTGC
GGACAGCCTCAGGGTTCTGCTGAGGGCCAGACGGCGCCGAAGTCGGGCAACGAGGATGAGATCGACTACTGCTAG
Gene >Ophio5|3284
ATGTATAGAATTTCGATGGCAGCCGGCGCCCTCGTGGCACTGCAGGGAGCCTGGGCCCAGCAGCCCTCTCAGACC
GATGTCTATCCTGCCGAGCACACGGAAGAGGTCAAGGGTTACGAGGGACAATATGTGGATGCCTGCTCGCCGGTT
GGCACCGTTCGATTCAACTCGACTTTCCCGCCTTGCCTGAGCGCTAGCAGGATCGAGCCCAGCTGTGCTCTTCCT
TGGAAGGAGGGTCTGTCGGATGAGCAGCGTCAGGGAGATTGGAAGGCGGAGAGGAAGTGTCTCTGCGACGGTAGC
TTCTTTGATGATGCTGGTGATGGGTGCCTCAAGTGCAAGGGGGCTTACCGTATCGACAGCGAGGAGAACCTTGCA
GTCTGGAAGGGCATTTGGGACAAGGTCCGTGGCAGCTACTGCCAGGATGAGACCCTGACGGGTAACTTCTCGTCG
TACTTCAAAGCAGCCTCAGACCAGTCTTCGTTCCAACCGGTCAAGGACCTTGGCACGAAGCCCGCAGCCGGAAGC
ATCCCGATCGAGGCCTACTACAAGAACGACAAGCAGGGCCCGGGCCCTCTCCCCGGCTCTACGTCCTCCAACTCG
ACCGCCCAGGACGAAGCCGGACCAATGGAGGGCGTCGCGCAGCTCACGCCCGACTGCCGCACCATGATTGGCGCC
ATCGATACGCTTCCGGGCGGCAACAGTGCCAAGTTTTCCAACTCGAGCTCGGGGGCCATTCTCGTCTCTGTGCAG
GCGACTTTCAACCGCATCTGCATCATCAACGGTGACCAGCGTGAAGTCAAGGCTGAGCGCAAGGAAGAGCCCGTT
GTTACGCCCATTTCGCAGGAGGTCGTGCCCAAGGAAAAGGCTGCGGAGAAGGCTGATTTCGATATGACGGGTTGC
TCGTGCGCTCAGAAGGTTGTTCCTGAGGGTAAGCAGGTTGTCCAGTCGAAGGAGTCCGTCGAGGCTTGGGCTATG
GTCTCTGTCATGACTGGATTCGCCATGGTTGGTGGACAGCTGCCGCAGGGCTGTGAGGGTGCTCAGTGCGGCGCT
CAGGGCGGTGCTGATGCCGGTGCTTCTGCTGGCAGTGAGGCATCATCTTCTGCCTCCGGCAACGTCTACTCCGTC
GACTCCGTCATGGGCACCTTCGGCGGATCGGCTGGTGGTTCGGCCCCTGCCTCTGGCGGCAAGTCTGCCGTCAAG
GCTCCGGCCTTTGTTGTGAAGCCTGGCGTCCAGGTCTCTGCCAAAGCCCAGTGTGGCGCTGACGGCTCTTGCGGA
CAGTCAAAGGGCTCCTATGGCCAAAAGACTGAGGGCGCCTCTGACGGAAAGCCCCAGTGCGCCGACGGCTCTTGC
GGACAGCCTCAGGGTTCTGCTGAGGGCCAGACGGCGCCGAAGTCGGGCAACGAGGATGAGATCGACTACTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail