Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3280
Gene name
Locationscaffold_26:51158..52646
Strand-
Gene length (bp)1488
Transcript length (bp)1428
Coding sequence length (bp)1425
Protein length (aa) 475

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08618 Opi1 Transcription factor Opi1 9.5E-27 234 392
PF08618 Opi1 Transcription factor Opi1 1.2E-07 403 444

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q01306|CCG8_NEUCR Clock-controlled protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccg-8 PE=2 SV=3 57 445 4.0E-68

GO

GO Term Description Terminal node
GO:0003714 transcription corepressor activity Yes
GO:0003712 transcription coregulator activity No
GO:0140110 transcription regulator activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3280
MPVSSPHDLDSPSPPPFKRHEPVIMPDPWNGSLAYRPPLAPVHAPSKGIDADVDRQLSLDDPDVRLAAEALGDLR
ADFVSTPPEPCSSPDRTSQSPRPEPLLSLLTTSHPLVASTIGGASSAYGGAKNLSPRFKSGAEYVEGYLTPIANT
VNSVGRVTGVEGGVRWFLGASRRHAAPDPEVGGYSHKRRKVCDGDVDLPGASLNLWSADPHRFDHRSPRRLSSTS
TVDTLPAYDELRSPAYTETTGSQAAPRPGPWQSRLMLSTSGLSVSMSAESLRSLKYCLRWLRWTNDHMGRVIGTL
KATIEEYEKTRPQASPTPPEADAPATSPEPGPEPSRLELINRINTLKSDILKTLQNTIETVSKYAGGALPENARV
LVRRHLTSLPQRFRIATMSTDGGEGRDAESAISEGAQKVLLLAKEGLDMVTQVSGVVDGTIMSAEEWCERMDGTR
QSPTDEEDQSGASQQEPGSGGVKMA
Coding >Ophio5|3280
ATGCCCGTCTCCTCCCCCCACGACCTCGACTCGCCGTCTCCGCCCCCGTTCAAGCGTCATGAGCCCGTGATCATG
CCCGATCCGTGGAACGGCTCGCTGGCCTATCGCCCTCCGCTGGCGCCCGTCCACGCTCCGTCCAAAGGCATTGAT
GCTGACGTCGATCGTCAACTATCCCTCGACGATCCCGATGTGCGCCTGGCCGCTGAGGCCTTGGGCGACCTGAGA
GCCGACTTCGTCTCGACGCCGCCGGAACCGTGCTCCTCGCCAGACCGGACCTCTCAGTCGCCCCGGCCAGAGCCG
CTACTGTCCCTTCTCACCACGTCACATCCTCTGGTTGCGAGCACCATCGGAGGCGCCAGCTCGGCCTATGGGGGA
GCTAAGAACTTGTCGCCGCGCTTCAAATCCGGTGCCGAATATGTCGAGGGCTATCTGACCCCCATCGCTAACACT
GTCAACTCGGTCGGCCGCGTCACCGGAGTCGAGGGCGGCGTCCGCTGGTTCCTCGGTGCCAGCCGCCGCCACGCC
GCCCCTGATCCTGAAGTTGGCGGTTACTCGCACAAGCGGCGTAAGGTCTGCGACGGCGATGTCGACCTCCCCGGC
GCTTCCCTCAACCTGTGGTCCGCCGACCCGCACCGCTTCGATCACCGAAGCCCTCGCCGCCTGTCTTCGACGAGC
ACCGTCGACACTCTACCAGCTTACGACGAGTTGCGGTCCCCCGCCTACACAGAGACGACGGGCTCACAAGCTGCG
CCGCGACCCGGCCCGTGGCAGTCGCGCCTGATGCTGTCCACTTCGGGTCTCAGCGTTTCCATGAGCGCCGAGAGC
TTGCGTAGTCTCAAGTACTGCCTGCGCTGGCTGCGCTGGACCAATGACCACATGGGTCGCGTCATCGGCACCCTC
AAGGCCACCATCGAAGAATACGAAAAGACACGGCCGCAGGCATCTCCGACTCCTCCAGAGGCCGACGCCCCTGCC
ACTAGTCCCGAGCCGGGCCCGGAGCCGTCGCGGCTCGAGCTCATCAACCGCATCAACACGCTCAAGTCGGACATA
CTCAAGACGCTTCAGAACACCATCGAGACGGTGTCCAAGTACGCCGGCGGCGCCCTGCCTGAGAACGCGCGTGTG
CTCGTCCGCCGCCACCTCACCAGCCTGCCTCAGCGCTTCCGCATTGCCACCATGTCGACTGACGGCGGCGAAGGC
AGGGACGCCGAGTCAGCCATCAGCGAGGGCGCACAGAAGGTGCTCCTCCTGGCCAAGGAGGGGCTCGACATGGTG
ACTCAAGTCAGCGGCGTCGTTGACGGCACCATCATGAGCGCCGAGGAGTGGTGCGAGCGCATGGACGGGACGAGG
CAGTCTCCGACGGACGAAGAGGACCAGTCTGGTGCGTCGCAACAGGAGCCCGGCAGTGGTGGTGTCAAGATGGCC
Transcript >Ophio5|3280
ATGCCCGTCTCCTCCCCCCACGACCTCGACTCGCCGTCTCCGCCCCCGTTCAAGCGTCATGAGCCCGTGATCATG
CCCGATCCGTGGAACGGCTCGCTGGCCTATCGCCCTCCGCTGGCGCCCGTCCACGCTCCGTCCAAAGGCATTGAT
GCTGACGTCGATCGTCAACTATCCCTCGACGATCCCGATGTGCGCCTGGCCGCTGAGGCCTTGGGCGACCTGAGA
GCCGACTTCGTCTCGACGCCGCCGGAACCGTGCTCCTCGCCAGACCGGACCTCTCAGTCGCCCCGGCCAGAGCCG
CTACTGTCCCTTCTCACCACGTCACATCCTCTGGTTGCGAGCACCATCGGAGGCGCCAGCTCGGCCTATGGGGGA
GCTAAGAACTTGTCGCCGCGCTTCAAATCCGGTGCCGAATATGTCGAGGGCTATCTGACCCCCATCGCTAACACT
GTCAACTCGGTCGGCCGCGTCACCGGAGTCGAGGGCGGCGTCCGCTGGTTCCTCGGTGCCAGCCGCCGCCACGCC
GCCCCTGATCCTGAAGTTGGCGGTTACTCGCACAAGCGGCGTAAGGTCTGCGACGGCGATGTCGACCTCCCCGGC
GCTTCCCTCAACCTGTGGTCCGCCGACCCGCACCGCTTCGATCACCGAAGCCCTCGCCGCCTGTCTTCGACGAGC
ACCGTCGACACTCTACCAGCTTACGACGAGTTGCGGTCCCCCGCCTACACAGAGACGACGGGCTCACAAGCTGCG
CCGCGACCCGGCCCGTGGCAGTCGCGCCTGATGCTGTCCACTTCGGGTCTCAGCGTTTCCATGAGCGCCGAGAGC
TTGCGTAGTCTCAAGTACTGCCTGCGCTGGCTGCGCTGGACCAATGACCACATGGGTCGCGTCATCGGCACCCTC
AAGGCCACCATCGAAGAATACGAAAAGACACGGCCGCAGGCATCTCCGACTCCTCCAGAGGCCGACGCCCCTGCC
ACTAGTCCCGAGCCGGGCCCGGAGCCGTCGCGGCTCGAGCTCATCAACCGCATCAACACGCTCAAGTCGGACATA
CTCAAGACGCTTCAGAACACCATCGAGACGGTGTCCAAGTACGCCGGCGGCGCCCTGCCTGAGAACGCGCGTGTG
CTCGTCCGCCGCCACCTCACCAGCCTGCCTCAGCGCTTCCGCATTGCCACCATGTCGACTGACGGCGGCGAAGGC
AGGGACGCCGAGTCAGCCATCAGCGAGGGCGCACAGAAGGTGCTCCTCCTGGCCAAGGAGGGGCTCGACATGGTG
ACTCAAGTCAGCGGCGTCGTTGACGGCACCATCATGAGCGCCGAGGAGTGGTGCGAGCGCATGGACGGGACGAGG
CAGTCTCCGACGGACGAAGAGGACCAGTCTGGTGCGTCGCAACAGGAGCCCGGCAGTGGTGGTGTCAAGATGGCC
TAG
Gene >Ophio5|3280
ATGCCCGTCTCCTCCCCCCACGACCTCGACTCGCCGTCTCCGCCCCCGTTCAAGCGTCATGAGCCCGTGATCATG
CCCGATCCGTGGAACGGCTCGCTGGCCTATCGCCCTCCGCTGGCGCCCGTCCACGCTCCGTCCAAAGGCATTGAT
GCTGACGTCGATCGTCAACTATCCCTCGACGATCCCGATGTGCGCCTGGCCGCTGAGGCCTTGGGCGACCTGAGA
GCCGGTCAGCCCCTCACCCCTGACTGGTCTTGTCTCCTCTGCCGCTGACCCGCTTCGCCTCCAGACTTCGTCTCG
ACGCCGCCGGAACCGTGCTCCTCGCCAGACCGGACCTCTCAGTCGCCCCGGCCAGAGCCGCTACTGTCCCTTCTC
ACCACGTCACATCCTCTGGTTGCGAGCACCATCGGAGGCGCCAGCTCGGCCTATGGGGGAGCTAAGAACTTGTCG
CCGCGCTTCAAATCCGGTGCCGAATATGTCGAGGGCTATCTGACCCCCATCGCTAACACTGTCAACTCGGTCGGC
CGCGTCACCGGAGTCGAGGGCGGCGTCCGCTGGTTCCTCGGTGCCAGCCGCCGCCACGCCGCCCCTGATCCTGAA
GTTGGCGGTTACTCGCACAAGCGGCGTAAGGTCTGCGACGGCGATGTCGACCTCCCCGGCGCTTCCCTCAACCTG
TGGTCCGCCGACCCGCACCGCTTCGATCACCGAAGCCCTCGCCGCCTGTCTTCGACGAGCACCGTCGACACTCTA
CCAGCTTACGACGAGTTGCGGTCCCCCGCCTACACAGAGACGACGGGCTCACAAGCTGCGCCGCGACCCGGCCCG
TGGCAGTCGCGCCTGATGCTGTCCACTTCGGGTCTCAGCGTTTCCATGAGCGCCGAGAGCTTGCGTAGTCTCAAG
TACTGCCTGCGCTGGCTGCGCTGGACCAATGACCACATGGGTCGCGTCATCGGCACCCTCAAGGCCACCATCGAA
GAATACGAAAAGACACGGCCGCAGGCATCTCCGACTCCTCCAGAGGCCGACGCCCCTGCCACTAGTCCCGAGCCG
GGCCCGGAGCCGTCGCGGCTCGAGCTCATCAACCGCATCAACACGCTCAAGTCGGACATACTCAAGACGCTTCAG
AACACCATCGAGACGGTGTCCAAGTACGCCGGCGGCGCCCTGCCTGAGAACGCGCGTGTGCTCGTCCGCCGCCAC
CTCACCAGCCTGCCTCAGCGCTTCCGCATTGCCACCATGTCGACTGACGGCGGCGAAGGCAGGGACGCCGAGTCA
GCCATCAGCGAGGGCGCACAGAAGGTGCTCCTCCTGGCCAAGGAGGGGCTCGACATGGTGACTCAAGTCAGCGGC
GTCGTTGACGGCACCATCATGAGCGCCGAGGAGTGGTGCGAGCGCATGGACGGGACGAGGCAGTCTCCGACGGAC
GAAGAGGACCAGTCTGGTGCGTCGCAACAGGAGCCCGGCAGTGGTGGTGTCAAGATGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail