Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3275
Gene name
Locationscaffold_26:41918..42732
Strand+
Gene length (bp)814
Transcript length (bp)687
Coding sequence length (bp)684
Protein length (aa) 228

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01965 DJ-1_PfpI DJ-1/PfpI family 4.8E-16 30 224

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04432|HSP31_YEAST Glutathione-independent glyoxalase HSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP31 PE=1 SV=1 1 218 7.0E-29
sp|Q5AF03|HSP31_CANAL Glyoxalase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GLX3 PE=1 SV=1 5 226 3.0E-25
sp|Q08914|HSP33_YEAST Probable glutathione-independent glyoxalase HSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP33 PE=1 SV=1 1 215 2.0E-20
sp|Q08992|HSP32_YEAST Probable glutathione-independent glyoxalase HSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP32 PE=2 SV=1 1 215 2.0E-20
sp|Q04902|SNO4_YEAST Probable glutathione-independent glyoxalase SNO4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO4 PE=3 SV=1 1 215 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04432|HSP31_YEAST Glutathione-independent glyoxalase HSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP31 PE=1 SV=1 1 218 7.0E-29
sp|Q5AF03|HSP31_CANAL Glyoxalase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GLX3 PE=1 SV=1 5 226 3.0E-25
sp|Q08914|HSP33_YEAST Probable glutathione-independent glyoxalase HSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP33 PE=1 SV=1 1 215 2.0E-20
sp|Q08992|HSP32_YEAST Probable glutathione-independent glyoxalase HSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP32 PE=2 SV=1 1 215 2.0E-20
sp|Q04902|SNO4_YEAST Probable glutathione-independent glyoxalase SNO4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNO4 PE=3 SV=1 1 215 2.0E-19
sp|O43084|HSP33_SCHPO Probable glutathione-independent glyoxalase hsp3103 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp3103 PE=3 SV=1 23 226 2.0E-17
sp|Q09675|HSP32_SCHPO Glutathione-independent glyoxalase hsp3102 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp3102 PE=1 SV=1 21 226 3.0E-16
sp|O74914|HSP31_SCHPO Glutathione-independent glyoxalase hsp3101 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp3101 PE=1 SV=1 23 224 2.0E-14
sp|Q10092|HSP34_SCHPO Probable glutathione-independent glyoxalase hsp3104 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp3104 PE=3 SV=1 65 212 2.0E-14
sp|Q32NG4|PDDC1_XENLA Parkinson disease 7 domain-containing protein 1 OS=Xenopus laevis GN=pddc1 PE=2 SV=1 32 214 7.0E-13
sp|Q29RZ1|PDDC1_BOVIN Parkinson disease 7 domain-containing protein 1 OS=Bos taurus GN=PDDC1 PE=2 SV=1 32 214 6.0E-11
sp|Q8BFQ8|PDDC1_MOUSE Parkinson disease 7 domain-containing protein 1 OS=Mus musculus GN=Pddc1 PE=1 SV=1 29 214 2.0E-10
sp|P45470|YHBO_ECOLI Protein YhbO OS=Escherichia coli (strain K12) GN=yhbO PE=1 SV=2 84 227 7.0E-10
sp|Q8NB37|PDDC1_HUMAN Parkinson disease 7 domain-containing protein 1 OS=Homo sapiens GN=PDDC1 PE=1 SV=1 32 214 9.0E-10
sp|Q58377|Y967_METJA Uncharacterized protein MJ0967 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0967 PE=3 SV=1 64 226 4.0E-09
sp|B5YSJ3|HCHA_ECO5E Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hchA PE=3 SV=1 32 226 7.0E-09
sp|Q8XB78|HCHA_ECO57 Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli O157:H7 GN=hchA PE=3 SV=3 32 226 7.0E-09
sp|B7L8Y4|HCHA_ECO55 Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli (strain 55989 / EAEC) GN=hchA PE=3 SV=1 32 226 7.0E-09
sp|P31658|HCHA_ECOLI Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli (strain K12) GN=hchA PE=1 SV=3 32 226 8.0E-09
sp|B1X6B7|HCHA_ECODH Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli (strain K12 / DH10B) GN=hchA PE=3 SV=1 32 226 8.0E-09
sp|C4ZQN7|HCHA_ECOBW Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hchA PE=3 SV=1 32 226 8.0E-09
sp|B7MWF3|HCHA_ECO81 Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli O81 (strain ED1a) GN=hchA PE=3 SV=1 32 226 2.0E-08
sp|A8A1G6|HCHA_ECOHS Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli O9:H4 (strain HS) GN=hchA PE=3 SV=1 32 226 2.0E-08
sp|B1IZU5|HCHA_ECOLC Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hchA PE=3 SV=1 32 226 2.0E-08
sp|B2TWL8|HCHA_SHIB3 Molecular chaperone Hsp31 and glyoxalase 3 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=hchA PE=3 SV=1 32 226 2.0E-08
sp|B7NBV8|HCHA_ECOLU Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hchA PE=3 SV=1 32 226 2.0E-08
sp|B7M3A5|HCHA_ECO8A Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli O8 (strain IAI1) GN=hchA PE=3 SV=1 32 226 2.0E-08
sp|A7ZN88|HCHA_ECO24 Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hchA PE=3 SV=1 32 226 2.0E-08
sp|B6I112|HCHA_ECOSE Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli (strain SE11) GN=hchA PE=3 SV=1 32 226 2.0E-08
sp|B1LQP2|HCHA_ECOSM Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hchA PE=3 SV=1 32 226 2.0E-08
sp|Q3Z0M5|HCHA_SHISS Molecular chaperone Hsp31 and glyoxalase 3 OS=Shigella sonnei (strain Ss046) GN=hchA PE=3 SV=1 32 226 3.0E-08
sp|O06006|YRAA_BACSU Putative cysteine protease YraA OS=Bacillus subtilis (strain 168) GN=yraA PE=2 SV=2 75 217 3.0E-08
sp|Q1RAH5|HCHA_ECOUT Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli (strain UTI89 / UPEC) GN=hchA PE=3 SV=1 32 226 4.0E-08
sp|A1ACB2|HCHA_ECOK1 Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli O1:K1 / APEC GN=hchA PE=3 SV=1 32 226 4.0E-08
sp|B7MCM0|HCHA_ECO45 Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=hchA PE=3 SV=1 32 226 4.0E-08
sp|Q5JGM7|PFPI_THEKO Intracellular protease 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pfpI PE=3 SV=1 75 226 4.0E-08
sp|O59413|PFPI_PYRHO Intracellular protease 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pfpI PE=1 SV=1 75 226 5.0E-08
sp|P59331|HCHA_ECOL6 Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hchA PE=3 SV=2 32 226 7.0E-08
sp|B7NRB5|HCHA_ECO7I Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hchA PE=3 SV=1 32 226 7.0E-08
sp|Q0TGM8|HCHA_ECOL5 Molecular chaperone Hsp31 and glyoxalase 3 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=hchA PE=3 SV=1 32 226 7.0E-08
sp|Q51732|PFPI_PYRFU Intracellular protease 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pfpI PE=1 SV=1 75 226 8.0E-08
sp|Q9M8R4|DJ1D_ARATH Protein DJ-1 homolog D OS=Arabidopsis thaliana GN=DJ1D PE=1 SV=1 57 148 8.0E-08
sp|Q9V1F8|PFPI_PYRAB Intracellular protease 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pfpI PE=3 SV=1 75 226 1.0E-07
sp|Q09918|HSP35_SCHPO Putative glutathione-independent glyoxalase hsp3105 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp3105 PE=3 SV=1 23 226 3.0E-07
sp|O28987|Y1281_ARCFU Uncharacterized protein AF_1281 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1281 PE=3 SV=1 87 212 3.0E-07
sp|P59332|HCHA_SHIFL Molecular chaperone Hsp31 and glyoxalase 3 OS=Shigella flexneri GN=hchA PE=3 SV=2 32 226 5.0E-07
sp|Q0T3G3|HCHA_SHIF8 Molecular chaperone Hsp31 and glyoxalase 3 OS=Shigella flexneri serotype 5b (strain 8401) GN=hchA PE=3 SV=1 32 226 5.0E-07
sp|Q9M8R4|DJ1D_ARATH Protein DJ-1 homolog D OS=Arabidopsis thaliana GN=DJ1D PE=1 SV=1 71 227 5.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.8633 0.4122 0.0862 0.0239 0.2682 0.0626 0.062 0.0295 0.0414 0.0167

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup747
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4397
Ophiocordyceps australis map64 (Brazil) OphauB2|8099
Ophiocordyceps camponoti-floridani Ophcf2|01586
Ophiocordyceps camponoti-rufipedis Ophun1|959
Ophiocordyceps kimflemingae Ophio5|3275 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2150

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3275
MAPKRILIVLTSADKITKLDKPTGWYLPELAHPFDVLDPKFELVTASPKGGEAPLDPGSVSAFASDASCTNFLDK
HADVYKKTRRLQDVSAADFDAVFYPGGHGPMYDLVDDAHSIRLIEEFWCAGKPVAAVCHGPIVFVRVAVDKGRVP
LLSGKRVTGFTNAEEKDVGLLDAMPLLLEDEAKKCGCEWEQAAEPWGECVVVDGNLITGQNPASAKAVGEALAKA
LGV
Coding >Ophio5|3275
ATGGCACCCAAGCGCATCCTCATCGTCCTCACCAGCGCCGACAAAATCACCAAGCTCGACAAGCCAACGGGCTGG
TATCTACCCGAGCTCGCCCACCCCTTCGACGTCCTCGACCCCAAATTCGAGCTTGTAACCGCTTCCCCAAAAGGT
GGCGAGGCGCCTCTCGATCCCGGCTCCGTCTCGGCCTTTGCCTCGGACGCATCATGCACCAACTTCCTCGACAAG
CACGCAGACGTGTACAAGAAGACGCGCCGACTCCAAGATGTCTCCGCCGCCGACTTTGACGCCGTCTTTTACCCG
GGCGGTCATGGTCCCATGTATGATCTCGTCGACGACGCACACTCCATCCGTCTAATTGAGGAGTTTTGGTGCGCC
GGGAAGCCTGTTGCTGCTGTGTGTCACGGGCCTATTGTTTTCGTGCGTGTTGCTGTGGATAAGGGCCGTGTTCCG
CTCTTGAGTGGGAAACGCGTTACGGGCTTTACCAATGCCGAGGAGAAAGACGTTGGGCTGCTGGATGCGATGCCG
TTGCTGCTTGAAGATGAGGCCAAGAAGTGCGGCTGCGAGTGGGAGCAGGCTGCTGAGCCGTGGGGCGAGTGCGTC
GTTGTCGATGGCAACCTCATCACGGGCCAGAATCCGGCTTCGGCCAAGGCAGTTGGCGAGGCGCTGGCCAAGGCA
CTGGGCGTC
Transcript >Ophio5|3275
ATGGCACCCAAGCGCATCCTCATCGTCCTCACCAGCGCCGACAAAATCACCAAGCTCGACAAGCCAACGGGCTGG
TATCTACCCGAGCTCGCCCACCCCTTCGACGTCCTCGACCCCAAATTCGAGCTTGTAACCGCTTCCCCAAAAGGT
GGCGAGGCGCCTCTCGATCCCGGCTCCGTCTCGGCCTTTGCCTCGGACGCATCATGCACCAACTTCCTCGACAAG
CACGCAGACGTGTACAAGAAGACGCGCCGACTCCAAGATGTCTCCGCCGCCGACTTTGACGCCGTCTTTTACCCG
GGCGGTCATGGTCCCATGTATGATCTCGTCGACGACGCACACTCCATCCGTCTAATTGAGGAGTTTTGGTGCGCC
GGGAAGCCTGTTGCTGCTGTGTGTCACGGGCCTATTGTTTTCGTGCGTGTTGCTGTGGATAAGGGCCGTGTTCCG
CTCTTGAGTGGGAAACGCGTTACGGGCTTTACCAATGCCGAGGAGAAAGACGTTGGGCTGCTGGATGCGATGCCG
TTGCTGCTTGAAGATGAGGCCAAGAAGTGCGGCTGCGAGTGGGAGCAGGCTGCTGAGCCGTGGGGCGAGTGCGTC
GTTGTCGATGGCAACCTCATCACGGGCCAGAATCCGGCTTCGGCCAAGGCAGTTGGCGAGGCGCTGGCCAAGGCA
CTGGGCGTCTAA
Gene >Ophio5|3275
ATGGCACCCAAGCGCATCCTCATCGTCCTCACCAGCGCCGACAAAATCACCAAGCTCGACAAGCCAACGGGCTGG
TATCTAGTATGTCCTCCCCTTCGCCTCCTCTCCTAACAAAACCCCTCCATCGCGAGACTCCAGCTCAACAAAAAA
ACACCAAGCCCGAGCTCGCCCACCCCTTCGACGTCCTCGACCCCAAATTCGAGCTTGTAACCGCTTCCCCAAAAG
GTGGCGAGGCGCCTCTCGATCCCGGCTCCGTCTCGGCCTTTGCCTCGGACGCATCATGCACCAACTTCCTCGACA
AGCACGCAGACGTGTACAAGAAGACGCGCCGACTCCAAGATGTCTCCGCCGCCGACTTTGACGCCGTCTTTTACC
CGGGCGGTCATGGTCCCATGTATGATCTCGTCGACGACGCACACTCCATCCGTCTAATTGAGGAGTTTTGGTGCG
CCGGGAAGCCTGTTGCTGCTGTGTGTCACGGGCCTATTGTTTTCGTGCGTGTTGCTGTGGATAAGGGCCGTGTTC
CGCTCTTGAGTGGGAAACGCGTTACGGGCTTTACCAATGCCGAGGAGAAAGACGTTGGGCTGCTGGATGCGATGC
CGTTGCTGCTTGAAGATGAGGCCAAGAAGTGCGGCTGCGAGTGGGAGCAGGCTGCTGAGCCGTGGGGCGAGTGCG
TCGTTGTCGATGGCAACCTCATCACGGGCCAGAATCCGGCTTCGGCCAAGGCAGTTGGCGAGGCGCTGGCCAAGG
CACTGGGTTAAGTCATTTGGTCGGAGTAAGTTGCCGCGCTGACGGGGGGATTCTAGGCGTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail