Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3266
Gene name
Locationscaffold_26:22005..23541
Strand+
Gene length (bp)1536
Transcript length (bp)1401
Coding sequence length (bp)1398
Protein length (aa) 466

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.2E-09 173 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 53 389 7.0E-17
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 1 403 4.0E-13
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 2 411 9.0E-12
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 63 391 9.0E-12
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 138 406 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 53 389 7.0E-17
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 1 403 4.0E-13
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 2 411 9.0E-12
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 63 391 9.0E-12
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 138 406 6.0E-11
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 1 375 2.0E-10
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 1 411 2.0E-09
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 1 375 6.0E-09
sp|Q9FGC7|ZEP_ARATH Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana GN=ZEP PE=1 SV=1 2 408 3.0E-08
sp|B5B0J6|HPXO_KLEOX FAD-dependent urate hydroxylase OS=Klebsiella oxytoca GN=hpxO PE=3 SV=1 151 426 2.0E-06
sp|Q96375|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1 1 366 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.5753 0.4667 0.0461 0.0213 0.2759 0.0393 0.5513 0.1451 0.344 0.0328

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4536
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4000
Ophiocordyceps australis map64 (Brazil) OphauB2|7464
Ophiocordyceps camponoti-floridani Ophcf2|06248
Ophiocordyceps camponoti-rufipedis Ophun1|5935
Ophiocordyceps kimflemingae Ophio5|3266 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9479

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3266
MKIVIVGAGVSGCATYLLLKKHLPKPLSAEPHDITIYEAYDTDKDTTPSARGQGPTHSSTLVVGGGLGVGANGLN
VLKRLDEDILCDVVRGGYVVPTMNMKSKTGRVLARVQPCGDGNGNADNGMSMVASSRHWLWRCLRTRVPDDAIVT
KRVSEVVANAQGRNVVRFADGTVVEADMVVGADGLKSLAKHALFPEADGDPFPPLYEGLVGVGGFIPSREVRDLV
EMGSMNYVFGGNGFFGYFFADSAESAPYRDSPFHVSEAGDSLGWWSTYSAEQCPTLETLDTDAVNRQLRERHRDW
EDPVVQKILESVEVTSMYPTWTMPPLPTWERNGVVLVGDAAHALPPTSGQGSSQSLEDAEALTLFLCHHLRRAYQ
EHKTDVASRKQLITTAAKQYMELRLPRVTKILHDARATQGSKRNMTLVQEYAMYVVLWIMGCFPSLMAKPLKTVI
EYNVAEEVKKILGKTD
Coding >Ophio5|3266
ATGAAGATCGTCATCGTTGGCGCGGGCGTCTCCGGATGCGCCACGTACCTGCTGCTCAAGAAGCACCTGCCCAAG
CCCTTGTCGGCAGAGCCGCACGACATCACAATCTACGAGGCCTACGACACGGACAAGGATACGACGCCGTCGGCT
CGGGGCCAGGGTCCGACACACTCCTCGACGCTCGTCGTTGGCGGTGGTCTGGGCGTCGGCGCCAATGGGCTCAAC
GTGCTGAAGCGCCTCGACGAGGATATCCTCTGCGACGTCGTCCGCGGCGGTTATGTCGTGCCGACGATGAACATG
AAGAGTAAGACGGGAAGGGTGCTCGCTCGGGTGCAGCCGTGCGGGGATGGAAACGGAAATGCGGACAACGGCATG
AGCATGGTCGCAAGCAGTCGCCATTGGCTCTGGAGGTGTCTTCGCACGCGAGTTCCGGACGACGCCATCGTGACC
AAGAGGGTGTCCGAGGTGGTGGCCAACGCTCAGGGTCGCAATGTGGTTCGATTCGCAGACGGGACTGTTGTCGAA
GCTGACATGGTCGTTGGTGCTGACGGCTTGAAGAGCCTAGCCAAGCACGCGCTGTTCCCGGAGGCAGACGGTGAT
CCGTTTCCACCCCTTTACGAAGGCCTGGTAGGCGTCGGCGGCTTCATCCCCTCGCGCGAGGTGAGGGACCTGGTG
GAAATGGGGTCGATGAACTATGTCTTCGGCGGAAATGGTTTCTTTGGCTACTTTTTCGCCGACAGCGCCGAGTCG
GCGCCGTACCGCGACTCACCCTTTCACGTGTCGGAGGCGGGTGATAGCCTCGGCTGGTGGTCGACGTACTCGGCC
GAACAGTGCCCAACGCTGGAGACGCTTGACACGGATGCCGTGAACCGACAGCTGCGGGAGCGGCATAGGGATTGG
GAGGACCCCGTGGTGCAGAAGATCCTCGAGTCGGTTGAGGTGACGAGCATGTATCCGACGTGGACGATGCCGCCA
CTGCCGACTTGGGAACGAAACGGCGTCGTCCTTGTCGGAGACGCGGCCCATGCCTTACCACCGACATCGGGGCAG
GGATCGTCGCAGTCGTTGGAGGACGCCGAGGCCTTGACCCTCTTCCTCTGCCACCATCTGCGCAGGGCGTATCAG
GAGCACAAGACGGACGTTGCCAGCCGCAAGCAGCTCATCACAACGGCAGCGAAGCAGTACATGGAGCTGCGACTG
CCCCGCGTCACCAAAATCCTGCACGACGCTCGGGCGACGCAGGGCTCAAAGCGGAACATGACGCTGGTGCAAGAG
TATGCCATGTATGTGGTGCTGTGGATCATGGGGTGCTTTCCCAGCCTCATGGCCAAGCCTTTGAAGACCGTCATC
GAGTACAACGTGGCGGAGGAGGTCAAGAAAATCCTTGGCAAGACAGAC
Transcript >Ophio5|3266
ATGAAGATCGTCATCGTTGGCGCGGGCGTCTCCGGATGCGCCACGTACCTGCTGCTCAAGAAGCACCTGCCCAAG
CCCTTGTCGGCAGAGCCGCACGACATCACAATCTACGAGGCCTACGACACGGACAAGGATACGACGCCGTCGGCT
CGGGGCCAGGGTCCGACACACTCCTCGACGCTCGTCGTTGGCGGTGGTCTGGGCGTCGGCGCCAATGGGCTCAAC
GTGCTGAAGCGCCTCGACGAGGATATCCTCTGCGACGTCGTCCGCGGCGGTTATGTCGTGCCGACGATGAACATG
AAGAGTAAGACGGGAAGGGTGCTCGCTCGGGTGCAGCCGTGCGGGGATGGAAACGGAAATGCGGACAACGGCATG
AGCATGGTCGCAAGCAGTCGCCATTGGCTCTGGAGGTGTCTTCGCACGCGAGTTCCGGACGACGCCATCGTGACC
AAGAGGGTGTCCGAGGTGGTGGCCAACGCTCAGGGTCGCAATGTGGTTCGATTCGCAGACGGGACTGTTGTCGAA
GCTGACATGGTCGTTGGTGCTGACGGCTTGAAGAGCCTAGCCAAGCACGCGCTGTTCCCGGAGGCAGACGGTGAT
CCGTTTCCACCCCTTTACGAAGGCCTGGTAGGCGTCGGCGGCTTCATCCCCTCGCGCGAGGTGAGGGACCTGGTG
GAAATGGGGTCGATGAACTATGTCTTCGGCGGAAATGGTTTCTTTGGCTACTTTTTCGCCGACAGCGCCGAGTCG
GCGCCGTACCGCGACTCACCCTTTCACGTGTCGGAGGCGGGTGATAGCCTCGGCTGGTGGTCGACGTACTCGGCC
GAACAGTGCCCAACGCTGGAGACGCTTGACACGGATGCCGTGAACCGACAGCTGCGGGAGCGGCATAGGGATTGG
GAGGACCCCGTGGTGCAGAAGATCCTCGAGTCGGTTGAGGTGACGAGCATGTATCCGACGTGGACGATGCCGCCA
CTGCCGACTTGGGAACGAAACGGCGTCGTCCTTGTCGGAGACGCGGCCCATGCCTTACCACCGACATCGGGGCAG
GGATCGTCGCAGTCGTTGGAGGACGCCGAGGCCTTGACCCTCTTCCTCTGCCACCATCTGCGCAGGGCGTATCAG
GAGCACAAGACGGACGTTGCCAGCCGCAAGCAGCTCATCACAACGGCAGCGAAGCAGTACATGGAGCTGCGACTG
CCCCGCGTCACCAAAATCCTGCACGACGCTCGGGCGACGCAGGGCTCAAAGCGGAACATGACGCTGGTGCAAGAG
TATGCCATGTATGTGGTGCTGTGGATCATGGGGTGCTTTCCCAGCCTCATGGCCAAGCCTTTGAAGACCGTCATC
GAGTACAACGTGGCGGAGGAGGTCAAGAAAATCCTTGGCAAGACAGACTAG
Gene >Ophio5|3266
ATGAAGATCGTCATCGTTGGCGCGGGCGTCTCCGGATGCGCCACGTACCTGCTGCTCAAGAAGCACCTGCCCAAG
CCCTTGTCGGCAGAGCCGCACGACATCACAATCTACGAGGCCTACGACACGGACAAGGATACGACGCCGTCGGCT
CGGGGCCAGGGTCCGACACACTCCTCGACGCTCGTCGTTGGCGGTGGTCTGGGCGTCGGCGCCAATGGGCTCAAC
GTGCTGAAGCGCCTCGACGAGGATATCCTCTGCGACGTCGTCCGCGGCGGTTATGTCGTGCCGACGATGAACATG
AAGAGTAAGACGGGAAGGGTGCTCGCTCGGGTGCAGCCGTGCGGGGATGGAAACGGAAATGCGGACAACGGCATG
AGCATGGTCGCAAGCAGTCGCCATTGGCTCTGGAGGTGTCTTCGCACGCGAGTTCCGGACGACGCCATCGTGACC
AAGAGGGTGTCCGAGGTGGTGGCCAACGCTCAGGGTCGCAATGTGGTTCGATTCGCAGACGGGACTGTTGTCGAA
GCTGACATGGTCGTTGGTGCTGACGGCTTGAAGAGCCTAGCCAAGCACGCGCTGTTCCCGGAGGCAGACGGTGAT
CCGTTTCCACCCCTTTACGAGTAAGCTCTCATCGTGTTTGGCGCGCAGAATGCGAGACTGACGATTCCCGTGCAG
AGGCCTGGTAGGCGTCGGCGGCTTCATCCCCTCGCGCGAGGTGAGGGACCTGGTGGAAATGGGGTCGATGAACTA
TGTCTTCGGCGGAAATGGTTTCTTTGGCTACTTTTTCGCCGACAGCGCCGAGTCGGCGCCGTACCGCGACTCACC
CTTTCACGTGTCGGAGGCGGGTGATAGCCTCGGCTGGTGGTCGACGTACTCGGCCGAACAGTGCCCAACGCTGGA
GACGCTTGACACGGATGCCGTGAACCGACAGCTGCGGGAGCGGCATAGGGATTGGGAGGACCCCGTGGTGCAGAA
GATCCTCGAGTCGGTTGAGGTGACGAGCATGTATCCGACGTGGACGATGCCGCCACTGCCGACTTGGGAACGAAA
CGGCGTCGTCCTTGTCGGAGACGCGGCCCATGCCTTACCACCGACATCGGGGCAGGGATCGTCGCAGTCGTTGGA
GGACGCCGAGGCCTTGACCCTCTTCCTCTGCCACCATCTGCGCAGGGCGTATCAGGAGCACAAGACGGACGTTGC
CAGCCGCAAGCAGCTCATCACAACGGCAGCGAAGCAGTACATGGAGCTGCGACTGCCCCGCGTCACCAAAATCCT
GCACGACGCTCGGGCGACGCAGGGCTCAAAGCGGAACATGACGCTGGTGCAAGAGTATGCCATGTATGTGGTGCT
GTGGATCATGGGTAGGTCTCTCGTTTAGCCCCCATTGTGCTGTTTCGCGAGTGAGGAGGTGGCTGATGATGATGA
TGATGATGATGCACAGGGTGCTTTCCCAGCCTCATGGCCAAGCCTTTGAAGACCGTCATCGAGTACAACGTGGCG
GAGGAGGTCAAGAAAATCCTTGGCAAGACAGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail