Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3254
Gene name
Locationscaffold_26:245..3043
Strand+
Gene length (bp)2798
Transcript length (bp)2739
Coding sequence length (bp)2736
Protein length (aa) 912

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 4.6E-109 202 714
PF14558 TRP_N ML-like domain 1.8E-39 57 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 21 468 2.0E-45
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 57 634 1.0E-25
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 65 680 4.0E-24
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 69 630 1.0E-23
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 65 718 6.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 21 468 2.0E-45
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 57 634 1.0E-25
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 65 680 4.0E-24
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 69 630 1.0E-23
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 65 718 6.0E-21
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 65 277 2.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 13 31 18
2 205 227 22
3 234 256 22
4 389 411 22
5 432 454 22
6 469 491 22
7 583 602 19
8 606 625 19
9 637 658 21
10 673 695 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 41.58 22.66 60.50
CcL In ants, during behavior modification 83.62 42.18 125.05
CcD In ants, recently dead 77.15 40.21 114.09

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.001851 yes
SC16a CcD 0.006824 yes
CcL CcD 0.782721 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3254
MLPPCRAMRSSTLVRCFFITLLLAYLTLVSADNRVYIKGDGIDGVSRQLDVARYPALYTGDFDDCLNNESLFNVT
KFDAAYYADNLTVVFHLDGTSNIRRENLILHISVEAYGENRFNMTYDPCKANIASMCPLSASVPVSAFATIPISP
NDVAGIPSIALGIPDLEGFARLQIFANSTQTQIGCFQAVMTNGNSFSQPRAVASVLGILTALAALASFATAVYGL
SISHMRMHYAHSFSVLIVFETFQSIFFSGALSVKWPSVLPAWWSNFAWSAGIFADRSLLDSLSIFTGSHANASHV
GGAGSFQINNSGGLLRQIYGRALAGMHLQARNELKTLRRRAAYNASNPYDYNWNGHPRAPGMPMPGTWPGFAGTL
SAVGVPPADVFMVALIWLLVVLAALVLFLVAAKLILDLLRRRKFVKSDGFDYFRSHLGGYVLATLLRTLFIAFFA
IMTLSMYQFSLRGPAGPTAIAVVVFIIFLLAVGGASALACHARLGQGKFEVVPDTVRIERGTLFGKLPFIAASRA
SRVGEEETSEKPYLLGAIPFFRVKFTDDDADRATVHRDEGFIKRFGWLAGRYRRTKWWFFSVYVAYLFVRACFIG
GGSRSPLAQVFGLFIFELLALLAIIKTSPFEGNRNTAMSTWMLSISKIATCGLSIAFLPDFNLSRIAATVIGIII
IVIQGFVAVAVLVLIGLGAVSTSMSLSRNREQFPASLDQTRIRYFVHMEAHAPDPPPRPKTKKLAGEVTAQPTSF
DVKGVRRAPKVEDVQGTPSAAASLRRSRANSASSLPRTGRSHRKSWTSKDMAQWDAEMNRGDIQRSNFSTRSGSS
LRLHGLAGETHAGSSSPARRPPPMTPMLESVESPVWGSLPSHSFAAEPETMAMDHSEKKAPVVENQTDGSAEDVP
RVAPRSGNTTDP
Coding >Ophio5|3254
ATGCTGCCTCCTTGCCGTGCCATGAGGTCGTCGACGCTCGTCCGCTGCTTCTTCATCACCCTGCTCCTCGCCTAC
TTGACCCTCGTCTCGGCCGATAACAGGGTCTACATCAAGGGCGATGGTATCGATGGCGTCTCGCGCCAGCTCGAC
GTTGCTCGCTACCCGGCTCTCTACACGGGCGACTTCGACGACTGCCTCAACAATGAGAGCCTATTCAACGTGACC
AAATTTGATGCTGCCTACTATGCCGACAACCTCACCGTCGTCTTCCACCTTGACGGCACCTCGAATATCAGGCGG
GAGAACCTTATACTACACATCTCCGTCGAAGCTTATGGCGAGAACCGCTTCAACATGACGTACGACCCGTGCAAG
GCCAACATCGCCAGCATGTGCCCTCTCAGCGCCAGCGTCCCGGTGTCGGCCTTTGCTACCATCCCCATTTCCCCC
AACGACGTCGCCGGCATCCCCTCCATTGCCCTCGGAATCCCCGACCTCGAGGGCTTCGCCCGCCTGCAAATCTTC
GCCAACTCGACGCAAACCCAGATTGGCTGCTTCCAAGCTGTCATGACCAACGGAAACTCCTTCTCTCAGCCCAGG
GCCGTCGCCTCCGTCCTGGGCATACTGACCGCCCTGGCCGCCCTGGCATCCTTCGCCACGGCCGTATACGGACTC
AGTATCTCGCACATGCGCATGCACTACGCCCACTCCTTCTCCGTCCTCATCGTCTTCGAGACCTTTCAGTCCATC
TTCTTCTCCGGCGCCCTCTCCGTCAAGTGGCCGAGCGTGCTGCCCGCCTGGTGGAGCAACTTTGCCTGGTCCGCC
GGCATCTTCGCAGACCGATCACTTCTCGACTCGTTGAGCATCTTCACCGGCTCCCACGCAAACGCCAGCCACGTT
GGCGGCGCCGGCTCCTTCCAGATCAACAACAGTGGCGGGCTGCTGCGCCAAATCTACGGCAGAGCGCTGGCTGGC
ATGCACCTCCAAGCGAGGAACGAGTTGAAGACGTTGAGACGCCGAGCTGCGTACAATGCGAGCAACCCCTACGAC
TACAATTGGAATGGCCATCCTCGCGCCCCGGGGATGCCTATGCCCGGCACCTGGCCTGGCTTTGCTGGCACGCTG
TCTGCAGTCGGCGTGCCCCCAGCCGATGTCTTTATGGTGGCTCTCATATGGCTGCTCGTCGTTTTGGCGGCCCTA
GTCCTCTTCCTCGTGGCTGCCAAGCTGATTCTGGATCTGCTGAGGAGGCGTAAGTTCGTCAAGTCAGACGGCTTC
GACTATTTCCGCTCCCATCTCGGCGGATACGTGCTTGCGACCCTGCTTCGGACCCTCTTCATCGCCTTCTTCGCC
ATCATGACTCTGTCCATGTACCAATTCTCGCTTCGCGGTCCGGCTGGACCGACAGCCATCGCTGTTGTTGTCTTC
ATCATCTTCCTGCTGGCTGTTGGCGGAGCATCGGCCCTCGCCTGCCATGCCAGGCTCGGCCAGGGCAAATTCGAA
GTCGTCCCTGACACGGTGCGCATCGAGCGCGGCACTCTCTTCGGTAAGTTACCCTTCATCGCAGCCTCGAGGGCA
AGCCGCGTGGGGGAGGAGGAGACGTCGGAGAAGCCGTACCTGCTCGGCGCCATACCCTTCTTCCGAGTCAAGTTC
ACCGACGACGACGCCGACAGAGCGACGGTCCATCGCGACGAAGGCTTCATCAAGAGGTTCGGTTGGCTTGCCGGA
CGCTACCGACGCACCAAGTGGTGGTTCTTCTCCGTCTACGTCGCCTATCTCTTCGTCAGGGCCTGCTTCATTGGT
GGCGGCTCCCGCAGTCCGCTGGCGCAGGTTTTCGGGCTTTTCATCTTTGAGCTCCTCGCTCTTCTGGCCATCATC
AAGACGAGTCCGTTCGAAGGGAACCGCAACACGGCCATGTCGACCTGGATGCTCTCCATCTCCAAGATTGCCACC
TGCGGGCTCTCCATCGCCTTCCTCCCAGACTTTAACCTCAGCCGCATCGCCGCCACCGTCATCGGCATCATCATC
ATCGTCATCCAGGGCTTCGTCGCTGTCGCCGTCCTCGTCCTCATCGGCCTGGGTGCCGTCTCGACGTCCATGTCC
CTCTCGCGCAACCGAGAGCAGTTCCCGGCGTCGCTGGACCAGACCCGGATCCGCTACTTTGTACATATGGAGGCC
CACGCTCCCGATCCGCCTCCGAGGCCCAAGACGAAGAAGCTCGCCGGCGAGGTGACGGCACAGCCTACCTCTTTT
GACGTCAAGGGTGTCCGCCGCGCCCCTAAGGTCGAGGACGTCCAAGGCACCCCCAGCGCGGCGGCCAGCCTCCGT
CGCAGCCGCGCAAACAGCGCCAGCAGCCTGCCAAGGACGGGCCGCTCGCACCGCAAGTCGTGGACGTCAAAGGAC
ATGGCGCAGTGGGACGCCGAGATGAACAGGGGCGATATCCAGCGGTCCAACTTCTCCACGCGCTCGGGCTCCTCA
CTTCGTCTCCACGGACTCGCCGGCGAGACTCACGCTGGCAGCAGTTCGCCGGCGAGGAGACCGCCCCCCATGACG
CCCATGCTGGAGTCTGTCGAGAGCCCTGTGTGGGGCAGCCTTCCTTCACATTCGTTTGCCGCGGAACCTGAGACC
ATGGCAATGGACCATTCGGAGAAAAAGGCGCCTGTGGTCGAGAATCAGACGGATGGCTCGGCCGAGGACGTGCCT
CGCGTCGCGCCGCGATCCGGAAACACCACCGACCCC
Transcript >Ophio5|3254
ATGCTGCCTCCTTGCCGTGCCATGAGGTCGTCGACGCTCGTCCGCTGCTTCTTCATCACCCTGCTCCTCGCCTAC
TTGACCCTCGTCTCGGCCGATAACAGGGTCTACATCAAGGGCGATGGTATCGATGGCGTCTCGCGCCAGCTCGAC
GTTGCTCGCTACCCGGCTCTCTACACGGGCGACTTCGACGACTGCCTCAACAATGAGAGCCTATTCAACGTGACC
AAATTTGATGCTGCCTACTATGCCGACAACCTCACCGTCGTCTTCCACCTTGACGGCACCTCGAATATCAGGCGG
GAGAACCTTATACTACACATCTCCGTCGAAGCTTATGGCGAGAACCGCTTCAACATGACGTACGACCCGTGCAAG
GCCAACATCGCCAGCATGTGCCCTCTCAGCGCCAGCGTCCCGGTGTCGGCCTTTGCTACCATCCCCATTTCCCCC
AACGACGTCGCCGGCATCCCCTCCATTGCCCTCGGAATCCCCGACCTCGAGGGCTTCGCCCGCCTGCAAATCTTC
GCCAACTCGACGCAAACCCAGATTGGCTGCTTCCAAGCTGTCATGACCAACGGAAACTCCTTCTCTCAGCCCAGG
GCCGTCGCCTCCGTCCTGGGCATACTGACCGCCCTGGCCGCCCTGGCATCCTTCGCCACGGCCGTATACGGACTC
AGTATCTCGCACATGCGCATGCACTACGCCCACTCCTTCTCCGTCCTCATCGTCTTCGAGACCTTTCAGTCCATC
TTCTTCTCCGGCGCCCTCTCCGTCAAGTGGCCGAGCGTGCTGCCCGCCTGGTGGAGCAACTTTGCCTGGTCCGCC
GGCATCTTCGCAGACCGATCACTTCTCGACTCGTTGAGCATCTTCACCGGCTCCCACGCAAACGCCAGCCACGTT
GGCGGCGCCGGCTCCTTCCAGATCAACAACAGTGGCGGGCTGCTGCGCCAAATCTACGGCAGAGCGCTGGCTGGC
ATGCACCTCCAAGCGAGGAACGAGTTGAAGACGTTGAGACGCCGAGCTGCGTACAATGCGAGCAACCCCTACGAC
TACAATTGGAATGGCCATCCTCGCGCCCCGGGGATGCCTATGCCCGGCACCTGGCCTGGCTTTGCTGGCACGCTG
TCTGCAGTCGGCGTGCCCCCAGCCGATGTCTTTATGGTGGCTCTCATATGGCTGCTCGTCGTTTTGGCGGCCCTA
GTCCTCTTCCTCGTGGCTGCCAAGCTGATTCTGGATCTGCTGAGGAGGCGTAAGTTCGTCAAGTCAGACGGCTTC
GACTATTTCCGCTCCCATCTCGGCGGATACGTGCTTGCGACCCTGCTTCGGACCCTCTTCATCGCCTTCTTCGCC
ATCATGACTCTGTCCATGTACCAATTCTCGCTTCGCGGTCCGGCTGGACCGACAGCCATCGCTGTTGTTGTCTTC
ATCATCTTCCTGCTGGCTGTTGGCGGAGCATCGGCCCTCGCCTGCCATGCCAGGCTCGGCCAGGGCAAATTCGAA
GTCGTCCCTGACACGGTGCGCATCGAGCGCGGCACTCTCTTCGGTAAGTTACCCTTCATCGCAGCCTCGAGGGCA
AGCCGCGTGGGGGAGGAGGAGACGTCGGAGAAGCCGTACCTGCTCGGCGCCATACCCTTCTTCCGAGTCAAGTTC
ACCGACGACGACGCCGACAGAGCGACGGTCCATCGCGACGAAGGCTTCATCAAGAGGTTCGGTTGGCTTGCCGGA
CGCTACCGACGCACCAAGTGGTGGTTCTTCTCCGTCTACGTCGCCTATCTCTTCGTCAGGGCCTGCTTCATTGGT
GGCGGCTCCCGCAGTCCGCTGGCGCAGGTTTTCGGGCTTTTCATCTTTGAGCTCCTCGCTCTTCTGGCCATCATC
AAGACGAGTCCGTTCGAAGGGAACCGCAACACGGCCATGTCGACCTGGATGCTCTCCATCTCCAAGATTGCCACC
TGCGGGCTCTCCATCGCCTTCCTCCCAGACTTTAACCTCAGCCGCATCGCCGCCACCGTCATCGGCATCATCATC
ATCGTCATCCAGGGCTTCGTCGCTGTCGCCGTCCTCGTCCTCATCGGCCTGGGTGCCGTCTCGACGTCCATGTCC
CTCTCGCGCAACCGAGAGCAGTTCCCGGCGTCGCTGGACCAGACCCGGATCCGCTACTTTGTACATATGGAGGCC
CACGCTCCCGATCCGCCTCCGAGGCCCAAGACGAAGAAGCTCGCCGGCGAGGTGACGGCACAGCCTACCTCTTTT
GACGTCAAGGGTGTCCGCCGCGCCCCTAAGGTCGAGGACGTCCAAGGCACCCCCAGCGCGGCGGCCAGCCTCCGT
CGCAGCCGCGCAAACAGCGCCAGCAGCCTGCCAAGGACGGGCCGCTCGCACCGCAAGTCGTGGACGTCAAAGGAC
ATGGCGCAGTGGGACGCCGAGATGAACAGGGGCGATATCCAGCGGTCCAACTTCTCCACGCGCTCGGGCTCCTCA
CTTCGTCTCCACGGACTCGCCGGCGAGACTCACGCTGGCAGCAGTTCGCCGGCGAGGAGACCGCCCCCCATGACG
CCCATGCTGGAGTCTGTCGAGAGCCCTGTGTGGGGCAGCCTTCCTTCACATTCGTTTGCCGCGGAACCTGAGACC
ATGGCAATGGACCATTCGGAGAAAAAGGCGCCTGTGGTCGAGAATCAGACGGATGGCTCGGCCGAGGACGTGCCT
CGCGTCGCGCCGCGATCCGGAAACACCACCGACCCCTGA
Gene >Ophio5|3254
ATGCTGCCTCCTTGCCGTGCCATGAGGTCGTCGACGCTCGTCCGCTGCTTCTTCATCACCCTGCTCCTCGCCTAC
TTGACCCTCGTCTCGGCCGATAACAGGGTCTACATCAAGGGCGATGGTATCGATGGCGTCTCGCGCCAGCTCGAC
GTTGCTCGCTACCCGGCTCTCTACACGGGCGACTTCGACGACTGCCTCAACAATGAGAGCCTATTCAACGTGACC
AAATTTGATGCTGCCTACTATGCCGACAACCTCACCGTCGTCTTCCACCTTGACGGCACCTCGAATATCAGGCGG
GAGAACCTTATACGTGCGTTGGTCCCCTATTTCTGACAGCCACCGGGCCCGTGTCTGACTCGCTCTCTTCAGTAC
ACATCTCCGTCGAAGCTTATGGCGAGAACCGCTTCAACATGACGTACGACCCGTGCAAGGCCAACATCGCCAGCA
TGTGCCCTCTCAGCGCCAGCGTCCCGGTGTCGGCCTTTGCTACCATCCCCATTTCCCCCAACGACGTCGCCGGCA
TCCCCTCCATTGCCCTCGGAATCCCCGACCTCGAGGGCTTCGCCCGCCTGCAAATCTTCGCCAACTCGACGCAAA
CCCAGATTGGCTGCTTCCAAGCTGTCATGACCAACGGAAACTCCTTCTCTCAGCCCAGGGCCGTCGCCTCCGTCC
TGGGCATACTGACCGCCCTGGCCGCCCTGGCATCCTTCGCCACGGCCGTATACGGACTCAGTATCTCGCACATGC
GCATGCACTACGCCCACTCCTTCTCCGTCCTCATCGTCTTCGAGACCTTTCAGTCCATCTTCTTCTCCGGCGCCC
TCTCCGTCAAGTGGCCGAGCGTGCTGCCCGCCTGGTGGAGCAACTTTGCCTGGTCCGCCGGCATCTTCGCAGACC
GATCACTTCTCGACTCGTTGAGCATCTTCACCGGCTCCCACGCAAACGCCAGCCACGTTGGCGGCGCCGGCTCCT
TCCAGATCAACAACAGTGGCGGGCTGCTGCGCCAAATCTACGGCAGAGCGCTGGCTGGCATGCACCTCCAAGCGA
GGAACGAGTTGAAGACGTTGAGACGCCGAGCTGCGTACAATGCGAGCAACCCCTACGACTACAATTGGAATGGCC
ATCCTCGCGCCCCGGGGATGCCTATGCCCGGCACCTGGCCTGGCTTTGCTGGCACGCTGTCTGCAGTCGGCGTGC
CCCCAGCCGATGTCTTTATGGTGGCTCTCATATGGCTGCTCGTCGTTTTGGCGGCCCTAGTCCTCTTCCTCGTGG
CTGCCAAGCTGATTCTGGATCTGCTGAGGAGGCGTAAGTTCGTCAAGTCAGACGGCTTCGACTATTTCCGCTCCC
ATCTCGGCGGATACGTGCTTGCGACCCTGCTTCGGACCCTCTTCATCGCCTTCTTCGCCATCATGACTCTGTCCA
TGTACCAATTCTCGCTTCGCGGTCCGGCTGGACCGACAGCCATCGCTGTTGTTGTCTTCATCATCTTCCTGCTGG
CTGTTGGCGGAGCATCGGCCCTCGCCTGCCATGCCAGGCTCGGCCAGGGCAAATTCGAAGTCGTCCCTGACACGG
TGCGCATCGAGCGCGGCACTCTCTTCGGTAAGTTACCCTTCATCGCAGCCTCGAGGGCAAGCCGCGTGGGGGAGG
AGGAGACGTCGGAGAAGCCGTACCTGCTCGGCGCCATACCCTTCTTCCGAGTCAAGTTCACCGACGACGACGCCG
ACAGAGCGACGGTCCATCGCGACGAAGGCTTCATCAAGAGGTTCGGTTGGCTTGCCGGACGCTACCGACGCACCA
AGTGGTGGTTCTTCTCCGTCTACGTCGCCTATCTCTTCGTCAGGGCCTGCTTCATTGGTGGCGGCTCCCGCAGTC
CGCTGGCGCAGGTTTTCGGGCTTTTCATCTTTGAGCTCCTCGCTCTTCTGGCCATCATCAAGACGAGTCCGTTCG
AAGGGAACCGCAACACGGCCATGTCGACCTGGATGCTCTCCATCTCCAAGATTGCCACCTGCGGGCTCTCCATCG
CCTTCCTCCCAGACTTTAACCTCAGCCGCATCGCCGCCACCGTCATCGGCATCATCATCATCGTCATCCAGGGCT
TCGTCGCTGTCGCCGTCCTCGTCCTCATCGGCCTGGGTGCCGTCTCGACGTCCATGTCCCTCTCGCGCAACCGAG
AGCAGTTCCCGGCGTCGCTGGACCAGACCCGGATCCGCTACTTTGTACATATGGAGGCCCACGCTCCCGATCCGC
CTCCGAGGCCCAAGACGAAGAAGCTCGCCGGCGAGGTGACGGCACAGCCTACCTCTTTTGACGTCAAGGGTGTCC
GCCGCGCCCCTAAGGTCGAGGACGTCCAAGGCACCCCCAGCGCGGCGGCCAGCCTCCGTCGCAGCCGCGCAAACA
GCGCCAGCAGCCTGCCAAGGACGGGCCGCTCGCACCGCAAGTCGTGGACGTCAAAGGACATGGCGCAGTGGGACG
CCGAGATGAACAGGGGCGATATCCAGCGGTCCAACTTCTCCACGCGCTCGGGCTCCTCACTTCGTCTCCACGGAC
TCGCCGGCGAGACTCACGCTGGCAGCAGTTCGCCGGCGAGGAGACCGCCCCCCATGACGCCCATGCTGGAGTCTG
TCGAGAGCCCTGTGTGGGGCAGCCTTCCTTCACATTCGTTTGCCGCGGAACCTGAGACCATGGCAATGGACCATT
CGGAGAAAAAGGCGCCTGTGGTCGAGAATCAGACGGATGGCTCGGCCGAGGACGTGCCTCGCGTCGCGCCGCGAT
CCGGAAACACCACCGACCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail