Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3253
Gene name
Locationscaffold_258:25777..26260
Strand-
Gene length (bp)483
Transcript length (bp)483
Coding sequence length (bp)480
Protein length (aa) 160

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.1087 0.2062 0.0556 0.0559 0.3463 0.0095 0.8981 0.3508 0.1412 0.1711

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 61 83 22
3 95 117 22
4 132 151 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 68.61 29.73 107.48
CcL In ants, during behavior modification 3.85 0.00 7.77
CcD In ants, recently dead 9.75 1.79 17.71

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.048833 yes

Orthologs

Orthofinder run ID4
Orthogroup3507
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2530
Ophiocordyceps australis map64 (Brazil) OphauB2|175
Ophiocordyceps camponoti-floridani Ophcf2|07076
Ophiocordyceps camponoti-rufipedis Ophun1|4415
Ophiocordyceps kimflemingae Ophio5|3253 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6721

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3253
MALQRVILRLPLAYRAFFLFIEPVSALAGAYYCHFRQDQYLELLLHGASTSSTSSPVPTTVSVALSQLANMYFFF
ALIESLVLRCTWDLRVWRTVLLVLLIADFGHLYSLLELGSAVYYDGAGWNVSLFFNIPWVYAGATMRMCFLAGVG
LQHSKRQKQQ
Coding >Ophio5|3253
ATGGCTCTCCAACGCGTCATTCTCCGCCTCCCGCTCGCCTACCGCGCCTTCTTCCTCTTCATCGAGCCTGTTTCC
GCTCTGGCCGGCGCATATTACTGTCACTTTCGCCAGGACCAGTATCTCGAGCTGCTGCTCCATGGCGCCTCTACT
TCTTCTACCTCTTCACCCGTGCCGACGACGGTATCCGTCGCGTTGTCGCAACTAGCCAACATGTATTTCTTCTTC
GCCCTTATCGAGTCGCTCGTTCTGCGCTGTACATGGGATCTGCGCGTCTGGCGTACCGTCTTGCTGGTGCTACTG
ATCGCCGACTTTGGTCATCTCTATTCACTCTTGGAACTCGGTTCTGCCGTCTATTACGACGGTGCTGGCTGGAAT
GTTAGCCTTTTCTTTAATATCCCTTGGGTTTATGCCGGGGCTACCATGAGGATGTGCTTCCTCGCTGGCGTCGGC
CTGCAGCATTCTAAGCGGCAGAAGCAGCAA
Transcript >Ophio5|3253
ATGGCTCTCCAACGCGTCATTCTCCGCCTCCCGCTCGCCTACCGCGCCTTCTTCCTCTTCATCGAGCCTGTTTCC
GCTCTGGCCGGCGCATATTACTGTCACTTTCGCCAGGACCAGTATCTCGAGCTGCTGCTCCATGGCGCCTCTACT
TCTTCTACCTCTTCACCCGTGCCGACGACGGTATCCGTCGCGTTGTCGCAACTAGCCAACATGTATTTCTTCTTC
GCCCTTATCGAGTCGCTCGTTCTGCGCTGTACATGGGATCTGCGCGTCTGGCGTACCGTCTTGCTGGTGCTACTG
ATCGCCGACTTTGGTCATCTCTATTCACTCTTGGAACTCGGTTCTGCCGTCTATTACGACGGTGCTGGCTGGAAT
GTTAGCCTTTTCTTTAATATCCCTTGGGTTTATGCCGGGGCTACCATGAGGATGTGCTTCCTCGCTGGCGTCGGC
CTGCAGCATTCTAAGCGGCAGAAGCAGCAATGA
Gene >Ophio5|3253
ATGGCTCTCCAACGCGTCATTCTCCGCCTCCCGCTCGCCTACCGCGCCTTCTTCCTCTTCATCGAGCCTGTTTCC
GCTCTGGCCGGCGCATATTACTGTCACTTTCGCCAGGACCAGTATCTCGAGCTGCTGCTCCATGGCGCCTCTACT
TCTTCTACCTCTTCACCCGTGCCGACGACGGTATCCGTCGCGTTGTCGCAACTAGCCAACATGTATTTCTTCTTC
GCCCTTATCGAGTCGCTCGTTCTGCGCTGTACATGGGATCTGCGCGTCTGGCGTACCGTCTTGCTGGTGCTACTG
ATCGCCGACTTTGGTCATCTCTATTCACTCTTGGAACTCGGTTCTGCCGTCTATTACGACGGTGCTGGCTGGAAT
GTTAGCCTTTTCTTTAATATCCCTTGGGTTTATGCCGGGGCTACCATGAGGATGTGCTTCCTCGCTGGCGTCGGC
CTGCAGCATTCTAAGCGGCAGAAGCAGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail