Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3249
Gene name
Locationscaffold_258:18321..18990
Strand+
Gene length (bp)669
Transcript length (bp)669
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit 9.1E-13 24 60

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27999|RPB9_YEAST DNA-directed RNA polymerase II subunit RPB9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB9 PE=1 SV=1 23 88 6.0E-22
sp|Q6FS48|RPB9_CANGA DNA-directed RNA polymerase II subunit RPB9 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPB9 PE=3 SV=1 23 88 6.0E-22
sp|Q755B3|RPB9_ASHGO DNA-directed RNA polymerase II subunit RPB9 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB9 PE=3 SV=1 23 88 1.0E-21
sp|Q6NLH0|RPB9A_ARATH DNA-directed RNA polymerases II, IV and V subunit 9A OS=Arabidopsis thaliana GN=NRPB9A PE=1 SV=1 23 99 9.0E-17
sp|Q8L5V0|RPB9B_ARATH DNA-directed RNA polymerases II, IV and V subunit 9B OS=Arabidopsis thaliana GN=NRPB9B PE=1 SV=1 23 99 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27999|RPB9_YEAST DNA-directed RNA polymerase II subunit RPB9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB9 PE=1 SV=1 23 88 6.0E-22
sp|Q6FS48|RPB9_CANGA DNA-directed RNA polymerase II subunit RPB9 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPB9 PE=3 SV=1 23 88 6.0E-22
sp|Q755B3|RPB9_ASHGO DNA-directed RNA polymerase II subunit RPB9 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB9 PE=3 SV=1 23 88 1.0E-21
sp|Q6NLH0|RPB9A_ARATH DNA-directed RNA polymerases II, IV and V subunit 9A OS=Arabidopsis thaliana GN=NRPB9A PE=1 SV=1 23 99 9.0E-17
sp|Q8L5V0|RPB9B_ARATH DNA-directed RNA polymerases II, IV and V subunit 9B OS=Arabidopsis thaliana GN=NRPB9B PE=1 SV=1 23 99 1.0E-16
sp|Q32P73|RPB9_BOVIN DNA-directed RNA polymerase II subunit RPB9 OS=Bos taurus GN=POLR2I PE=2 SV=1 22 100 4.0E-16
sp|P60899|RPB9_PIG DNA-directed RNA polymerase II subunit RPB9 OS=Sus scrofa GN=POLR2I PE=3 SV=1 22 100 5.0E-16
sp|P60898|RPB9_MOUSE DNA-directed RNA polymerase II subunit RPB9 OS=Mus musculus GN=Polr2i PE=1 SV=1 22 100 5.0E-16
sp|P36954|RPB9_HUMAN DNA-directed RNA polymerase II subunit RPB9 OS=Homo sapiens GN=POLR2I PE=1 SV=1 22 100 5.0E-16
sp|P36958|RPB9_DROME DNA-directed RNA polymerase II subunit RPB9 OS=Drosophila melanogaster GN=RpII15 PE=2 SV=2 22 88 5.0E-15
sp|O74635|RPB9_SCHPO DNA-directed RNA polymerase II subunit RPB9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb9 PE=1 SV=1 24 88 4.0E-13
sp|Q8SQU1|RPB9_ENCCU DNA-directed RNA polymerase II subunit RPB9 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPB9 PE=3 SV=1 25 100 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0009987 cellular process No
GO:0032774 RNA biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0016070 RNA metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3249
MATPQSTTSQDDGSGAKKLEQITFRFCSECSNMLYPKEDKDAHSLQFTCRTCQYTEEASSSCVFRNVLNNSAGET
AGVTQDVGSDPTVSDVLPVFCLTCGTVILCGQCNDSPAYMSVVKRQDKRDEDSGFDNYVLTAGIVPFTEYDEYFE
GDDHNEAAAAAPDVSHAVNGNATVVSDLVPVSSGEKPDGTPAVNDTGLAPCVDRVMRNAMVLRGNGTPATHN
Coding >Ophio5|3249
ATGGCCACTCCTCAGTCCACCACTTCGCAGGACGACGGCTCCGGCGCCAAGAAGCTCGAGCAGATCACCTTTCGA
TTCTGCTCTGAGTGTTCCAACATGCTTTACCCCAAGGAAGACAAGGATGCTCACAGCCTTCAGTTTACTTGCCGC
ACTTGCCAGTACACTGAGGAGGCTTCCTCCAGCTGCGTCTTCCGCAACGTTCTCAACAACTCGGCTGGCGAGACC
GCTGGCGTGACGCAGGACGTGGGCTCTGATCCAACGGTTAGTGACGTTCTGCCTGTCTTTTGTCTCACTTGCGGC
ACCGTCATTCTCTGCGGCCAGTGCAACGACTCGCCCGCCTACATGTCCGTCGTCAAGCGACAGGACAAGCGTGAT
GAGGACTCGGGCTTCGACAATTATGTCCTTACCGCCGGCATCGTCCCTTTCACCGAGTACGACGAGTACTTCGAG
GGTGATGACCACAACGAAGCCGCTGCAGCCGCTCCTGACGTGTCCCATGCCGTCAACGGCAATGCCACCGTCGTG
AGCGACCTCGTCCCCGTCTCGAGCGGCGAGAAACCTGACGGAACCCCCGCCGTCAATGATACCGGCCTGGCCCCG
TGCGTCGATAGGGTGATGCGCAACGCCATGGTCCTCCGTGGCAACGGGACCCCCGCCACCCACAAC
Transcript >Ophio5|3249
ATGGCCACTCCTCAGTCCACCACTTCGCAGGACGACGGCTCCGGCGCCAAGAAGCTCGAGCAGATCACCTTTCGA
TTCTGCTCTGAGTGTTCCAACATGCTTTACCCCAAGGAAGACAAGGATGCTCACAGCCTTCAGTTTACTTGCCGC
ACTTGCCAGTACACTGAGGAGGCTTCCTCCAGCTGCGTCTTCCGCAACGTTCTCAACAACTCGGCTGGCGAGACC
GCTGGCGTGACGCAGGACGTGGGCTCTGATCCAACGGTTAGTGACGTTCTGCCTGTCTTTTGTCTCACTTGCGGC
ACCGTCATTCTCTGCGGCCAGTGCAACGACTCGCCCGCCTACATGTCCGTCGTCAAGCGACAGGACAAGCGTGAT
GAGGACTCGGGCTTCGACAATTATGTCCTTACCGCCGGCATCGTCCCTTTCACCGAGTACGACGAGTACTTCGAG
GGTGATGACCACAACGAAGCCGCTGCAGCCGCTCCTGACGTGTCCCATGCCGTCAACGGCAATGCCACCGTCGTG
AGCGACCTCGTCCCCGTCTCGAGCGGCGAGAAACCTGACGGAACCCCCGCCGTCAATGATACCGGCCTGGCCCCG
TGCGTCGATAGGGTGATGCGCAACGCCATGGTCCTCCGTGGCAACGGGACCCCCGCCACCCACAACTAA
Gene >Ophio5|3249
ATGGCCACTCCTCAGTCCACCACTTCGCAGGACGACGGCTCCGGCGCCAAGAAGCTCGAGCAGATCACCTTTCGA
TTCTGCTCTGAGTGTTCCAACATGCTTTACCCCAAGGAAGACAAGGATGCTCACAGCCTTCAGTTTACTTGCCGC
ACTTGCCAGTACACTGAGGAGGCTTCCTCCAGCTGCGTCTTCCGCAACGTTCTCAACAACTCGGCTGGCGAGACC
GCTGGCGTGACGCAGGACGTGGGCTCTGATCCAACGGTTAGTGACGTTCTGCCTGTCTTTTGTCTCACTTGCGGC
ACCGTCATTCTCTGCGGCCAGTGCAACGACTCGCCCGCCTACATGTCCGTCGTCAAGCGACAGGACAAGCGTGAT
GAGGACTCGGGCTTCGACAATTATGTCCTTACCGCCGGCATCGTCCCTTTCACCGAGTACGACGAGTACTTCGAG
GGTGATGACCACAACGAAGCCGCTGCAGCCGCTCCTGACGTGTCCCATGCCGTCAACGGCAATGCCACCGTCGTG
AGCGACCTCGTCCCCGTCTCGAGCGGCGAGAAACCTGACGGAACCCCCGCCGTCAATGATACCGGCCTGGCCCCG
TGCGTCGATAGGGTGATGCGCAACGCCATGGTCCTCCGTGGCAACGGGACCCCCGCCACCCACAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail