Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3246
Gene name
Locationscaffold_258:11995..13074
Strand-
Gene length (bp)1079
Transcript length (bp)840
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 5.6E-30 60 255

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P04963|PRXC_LEPFU Chloroperoxidase OS=Leptoxyphium fumago GN=CPO PE=1 SV=3 56 158 3.0E-09
sp|Q00668|STCC_EMENI Putative sterigmatocystin biosynthesis peroxidase stcC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcC PE=3 SV=2 42 154 5.0E-08
sp|B9W4V6|APO1_AGRAE Aromatic peroxygenase OS=Agrocybe aegerita GN=APO1 PE=1 SV=1 34 183 2.0E-07
sp|B9W4V8|APO1_COPRA Aromatic peroxygenase (Fragments) OS=Coprinellus radians GN=APO PE=1 SV=2 59 101 8.0E-06

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003674 molecular_function No
GO:0016209 antioxidant activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 62.27 31.78 92.77
CcL In ants, during behavior modification 30.51 13.25 47.77
CcD In ants, recently dead 40.07 18.76 61.38

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.005848 yes
SC16a CcD 0.080667 no
CcL CcD 0.347372 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3246
MRLPAGWLLTLSLLICSAEAGIFDFIFGGPKKPPQAKVRKSGLPDAFIKAFEARQPVDNHEWKSPPSGAARGPCP
ALNTLANHGYLRRDGKNITLAQVIDASFNAWLLLPDMTGLITARGIANSNHGLDHQFNLTITGHPSWRMEHDCSF
SRLDRKEGNPIPFNQNVWFSSLFDLFGGSVFRLLTFQSTLITPRLLAKAKAARLRDIFKRCDYSGLAAAEGALEI
GMVISALQENNKGAAKLSYVRGLFEQEKIVNDDDDDKGVEQNVFVVVHDVAEDD
Coding >Ophio5|3246
ATGAGGCTCCCTGCAGGCTGGCTGCTTACCCTCTCTCTTCTGATCTGCTCGGCGGAGGCCGGAATCTTTGACTTC
ATCTTTGGCGGTCCTAAGAAACCACCACAAGCCAAGGTTAGGAAATCCGGGTTACCGGATGCTTTTATCAAAGCG
TTTGAGGCGCGACAGCCCGTCGATAACCATGAGTGGAAAAGTCCGCCGTCCGGAGCCGCTCGCGGGCCGTGTCCG
GCTCTCAACACGCTGGCCAACCACGGCTACCTCCGACGGGACGGGAAGAACATCACGCTGGCACAAGTCATCGAC
GCCTCCTTCAACGCCTGGCTGCTCCTCCCGGACATGACGGGGCTCATCACGGCGCGAGGCATCGCCAACAGCAAC
CACGGCCTCGACCACCAGTTCAACCTGACCATCACGGGGCACCCATCGTGGAGGATGGAACACGACTGCAGCTTC
TCGCGTCTGGACCGGAAGGAAGGCAACCCGATCCCCTTCAACCAAAACGTCTGGTTCTCCAGTCTATTCGACCTC
TTCGGCGGCTCCGTCTTCCGTCTCCTCACTTTTCAATCCACCCTCATCACGCCCCGGCTCCTGGCCAAGGCCAAA
GCGGCCCGTCTCCGCGACATATTCAAGAGATGCGATTACTCGGGCTTGGCAGCGGCCGAAGGTGCCCTCGAAATC
GGCATGGTCATCAGCGCCCTGCAAGAGAATAATAAGGGCGCCGCCAAACTGAGCTATGTCCGAGGTCTCTTCGAA
CAGGAGAAGATTGTGAACGATGATGATGATGATAAAGGCGTCGAGCAGAATGTTTTTGTCGTCGTCCACGACGTT
GCAGAAGACGAC
Transcript >Ophio5|3246
ATGAGGCTCCCTGCAGGCTGGCTGCTTACCCTCTCTCTTCTGATCTGCTCGGCGGAGGCCGGAATCTTTGACTTC
ATCTTTGGCGGTCCTAAGAAACCACCACAAGCCAAGGTTAGGAAATCCGGGTTACCGGATGCTTTTATCAAAGCG
TTTGAGGCGCGACAGCCCGTCGATAACCATGAGTGGAAAAGTCCGCCGTCCGGAGCCGCTCGCGGGCCGTGTCCG
GCTCTCAACACGCTGGCCAACCACGGCTACCTCCGACGGGACGGGAAGAACATCACGCTGGCACAAGTCATCGAC
GCCTCCTTCAACGCCTGGCTGCTCCTCCCGGACATGACGGGGCTCATCACGGCGCGAGGCATCGCCAACAGCAAC
CACGGCCTCGACCACCAGTTCAACCTGACCATCACGGGGCACCCATCGTGGAGGATGGAACACGACTGCAGCTTC
TCGCGTCTGGACCGGAAGGAAGGCAACCCGATCCCCTTCAACCAAAACGTCTGGTTCTCCAGTCTATTCGACCTC
TTCGGCGGCTCCGTCTTCCGTCTCCTCACTTTTCAATCCACCCTCATCACGCCCCGGCTCCTGGCCAAGGCCAAA
GCGGCCCGTCTCCGCGACATATTCAAGAGATGCGATTACTCGGGCTTGGCAGCGGCCGAAGGTGCCCTCGAAATC
GGCATGGTCATCAGCGCCCTGCAAGAGAATAATAAGGGCGCCGCCAAACTGAGCTATGTCCGAGGTCTCTTCGAA
CAGGAGAAGATTGTGAACGATGATGATGATGATAAAGGCGTCGAGCAGAATGTTTTTGTCGTCGTCCACGACGTT
GCAGAAGACGACTGA
Gene >Ophio5|3246
ATGAGGCTCCCTGCAGGCTGGCTGCTTACCCTCTCTCTTCTGATCTGCTCGGCGGAGGCCGGAATCTTTGACTTC
ATCTTTGGCGGTCCTAAGAAACCACCACAAGCCAAGGTTAGGAAATCCGGGTTACCGGATGGTAAGAAGAAAAAC
CGTTTCTTTCTCTCATTTATTTTTTTTTTCGAAGAAAAGGGATGAAGAAGACTGACCCCTTTTTTTAATTCTCTC
TCTCTCTCTTTTGCGTCCACAGCTTTTATCAAAGCGTTTGAGGCGCGACAGCCCGTCGATAACCATGAGTGGAAA
AGTCCGCCGTCCGGAGCCGGTACATACCGAACCCTTCCTCCCCCCCCCCCCAAAAGAGCGGGAAAAGGGGGAAAC
AAAGGTCGCTGACGGAGAGCCATGACAGCTCGCGGGCCGTGTCCGGCTCTCAACACGCTGGCCAACCACGGCTAC
CTCCGACGGGACGGGAAGAACATCACGCTGGCACAAGTCATCGACGCCTCCTTCAACGCCTGGCTGCTCCTCCCG
GACATGACGGGGCTCATCACGGCGCGAGGCATCGCCAACAGCAACCACGGCCTCGACCACCAGTTCAACCTGACC
ATCACGGGGCACCCATCGTGGAGGATGGAACACGACTGCAGCTTCTCGCGTCTGGACCGGAAGGAAGGCAACCCG
ATCCCCTTCAACCAAAACGTCTGGTTCTCCAGTCTATTCGACCTCTTCGGCGGCTCCGTCTTCCGTCTCCTCACT
TTTCAATCCACCCTCATCACGCCCCGGCTCCTGGCCAAGGCCAAAGCGGCCCGTCTCCGCGACATATTCAAGAGA
TGCGATTACTCGGGCTTGGCAGCGGCCGAAGGTGCCCTCGAAATCGGCATGGTCATCAGCGCCCTGCAAGAGAAT
AATAAGGGCGCCGCCAAACTGAGCTATGTCCGAGGTCTCTTCGAACAGGAGAAGATTGTGAACGATGATGATGAT
GATAAAGGCGTCGAGCAGAATGTTTTTGTCGGTGGCATCTCCGGCACCTTGAAGCTGGCGCAGGACGCGTTGCAG
TCGTCCACGACGTTGCAGAAGACGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail