Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3244
Gene name
Locationscaffold_258:6552..8426
Strand+
Gene length (bp)1874
Transcript length (bp)1740
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08375 Rpn3_C Proteasome regulatory subunit C-terminal 2.4E-26 505 568
PF01399 PCI PCI domain 4.9E-20 400 498

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42897|RPN3_SCHPO Probable 26S proteasome regulatory subunit rpn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn3 PE=3 SV=2 87 573 2.0E-140
sp|P14685|PSMD3_MOUSE 26S proteasome non-ATPase regulatory subunit 3 OS=Mus musculus GN=Psmd3 PE=1 SV=3 64 568 1.0E-124
sp|O43242|PSMD3_HUMAN 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens GN=PSMD3 PE=1 SV=2 64 568 2.0E-124
sp|Q2KJ46|PSMD3_BOVIN 26S proteasome non-ATPase regulatory subunit 3 OS=Bos taurus GN=PSMD3 PE=2 SV=1 90 568 3.0E-124
sp|O61470|PSMD3_ANOGA Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Anopheles gambiae GN=Dox-A2 PE=3 SV=2 68 568 3.0E-121
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42897|RPN3_SCHPO Probable 26S proteasome regulatory subunit rpn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn3 PE=3 SV=2 87 573 2.0E-140
sp|P14685|PSMD3_MOUSE 26S proteasome non-ATPase regulatory subunit 3 OS=Mus musculus GN=Psmd3 PE=1 SV=3 64 568 1.0E-124
sp|O43242|PSMD3_HUMAN 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens GN=PSMD3 PE=1 SV=2 64 568 2.0E-124
sp|Q2KJ46|PSMD3_BOVIN 26S proteasome non-ATPase regulatory subunit 3 OS=Bos taurus GN=PSMD3 PE=2 SV=1 90 568 3.0E-124
sp|O61470|PSMD3_ANOGA Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Anopheles gambiae GN=Dox-A2 PE=3 SV=2 68 568 3.0E-121
sp|Q9U5Z8|PSMD3_ANOST Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Anopheles stephensi GN=DOXA2 PE=3 SV=1 68 569 1.0E-117
sp|P25161|PSMD3_DROME Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Drosophila melanogaster GN=Rpn3 PE=2 SV=1 62 568 2.0E-117
sp|Q1ZXD3|PSMD3_DICDI 26S proteasome non-ATPase regulatory subunit 3 OS=Dictyostelium discoideum GN=psmD3 PE=1 SV=1 67 576 3.0E-115
sp|Q9LNU4|PSD3A_ARATH 26S proteasome non-ATPase regulatory subunit 3 homolog A OS=Arabidopsis thaliana GN=RPN3A PE=1 SV=3 68 569 8.0E-91
sp|P40016|RPN3_YEAST 26S proteasome regulatory subunit RPN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN3 PE=1 SV=5 98 576 3.0E-89
sp|P93768|PSMD3_TOBAC Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Nicotiana tabacum GN=21D7 PE=2 SV=1 168 569 2.0E-87
sp|Q9LQR8|PSD3B_ARATH 26S proteasome non-ATPase regulatory subunit 3 homolog B OS=Arabidopsis thaliana GN=RPN3B PE=1 SV=2 68 569 2.0E-86
sp|Q06364|PSMD3_DAUCA Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Daucus carota GN=21D7 PE=1 SV=2 85 569 7.0E-86
sp|Q04908|PSMD3_CAEEL 26S proteasome non-ATPase regulatory subunit 3 OS=Caenorhabditis elegans GN=rpn-3 PE=1 SV=1 87 572 6.0E-82
sp|Q8SRT7|RPN3_ENCCU 26S proteasome regulatory subunit RPN3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPN3 PE=1 SV=1 307 537 1.0E-13
sp|O88543|CSN3_MOUSE COP9 signalosome complex subunit 3 OS=Mus musculus GN=Cops3 PE=1 SV=3 329 534 6.0E-07
sp|Q5RFS2|CSN3_PONAB COP9 signalosome complex subunit 3 OS=Pongo abelii GN=COPS3 PE=2 SV=1 329 534 1.0E-06
sp|Q4R898|CSN3_MACFA COP9 signalosome complex subunit 3 OS=Macaca fascicularis GN=COPS3 PE=2 SV=1 329 534 1.0E-06
sp|Q9UNS2|CSN3_HUMAN COP9 signalosome complex subunit 3 OS=Homo sapiens GN=COPS3 PE=1 SV=3 329 534 1.0E-06
sp|Q68FW9|CSN3_RAT COP9 signalosome complex subunit 3 OS=Rattus norvegicus GN=Cops3 PE=1 SV=1 329 534 1.0E-06
sp|A6H7B5|CSN3_BOVIN COP9 signalosome complex subunit 3 OS=Bos taurus GN=COPS3 PE=2 SV=1 329 534 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000502 proteasome complex Yes
GO:0030234 enzyme regulator activity Yes
GO:0042176 regulation of protein catabolic process Yes
GO:1905368 peptidase complex No
GO:0008150 biological_process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0009894 regulation of catabolic process No
GO:0032991 protein-containing complex No
GO:0019222 regulation of metabolic process No
GO:0065007 biological regulation No
GO:1905369 endopeptidase complex No
GO:1902494 catalytic complex No
GO:0003674 molecular_function No
GO:0051246 regulation of protein metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0140535 intracellular protein-containing complex No
GO:0080090 regulation of primary metabolic process No
GO:0098772 molecular function regulator activity No
GO:0005575 cellular_component No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3244
MPGKLPPSNGDQPLGNGVRSTNDDVDTKDAAKTKGKKAAKDGDDEMTVVLPPSKASKQPSQSQDSDGDVSMTDDT
DAEVKVDPALQAVADIKSNFALLDRAVALFDARFSLRALRSISLIRKRLTPDIIGQAIVDTFPATVTSGNIAKHL
LVAIGRESMPLGRQPGPEMEMDVDGKPAKNGAAKKEVKEIIPEIDIFLGILIQVYLFDSKQYQKGADFSRYLAER
IQSLNRRTLDSLSAKAFFYYSLFCEHIAPLPPSPESPIVAIRPTLLAALRTAVLRKDIDTQASVIVLLLRNYLLT
SHINQADLLVSHTQFPENAVNNQVARFLYYLGRIKAIQLRYTEAHEHLTAATRKAPSSGCAVGFSQTATKLLLVV
ELLMGDIPDRATFRLPSLEAALHPYFLLVQAVRVGNLEDFETTIADHADTFRRDGTYTLILRLRQNVIKTGIRMM
SLSYSRISLRDICIRLHLGSEESAEYIVAKAIRDGVIEATLDRERGFMKSNEIGDVYATREPGEAFHDRIQACLA
LHNESVKAMRFPMNQHRLELKNAQEAREREREMAKEIQEGDLDEDDLGGDFEGM
Coding >Ophio5|3244
ATGCCCGGAAAACTCCCCCCAAGCAACGGTGACCAACCGCTTGGGAACGGCGTCAGGAGCACCAACGACGATGTC
GACACGAAGGACGCCGCAAAGACCAAGGGCAAAAAGGCCGCCAAGGATGGCGACGATGAGATGACCGTAGTGCTT
CCTCCGTCCAAGGCATCCAAGCAACCCAGTCAATCGCAGGATTCTGATGGCGACGTTTCCATGACGGACGACACC
GACGCAGAAGTCAAGGTCGATCCCGCCCTCCAGGCTGTGGCAGACATCAAGAGCAATTTTGCACTGCTTGACCGT
GCCGTCGCTCTCTTCGATGCCAGATTTTCCCTCCGAGCCCTGCGTTCCATCTCTCTCATTCGCAAGCGCCTGACG
CCCGACATCATCGGGCAGGCCATCGTCGACACTTTCCCCGCCACCGTGACGTCTGGAAACATTGCCAAGCATCTC
CTGGTCGCTATCGGCCGCGAGAGCATGCCGCTCGGAAGGCAGCCTGGACCCGAGATGGAGATGGACGTCGATGGA
AAGCCGGCAAAGAACGGCGCGGCCAAGAAGGAGGTCAAGGAAATCATCCCCGAAATCGACATCTTTCTCGGCATC
CTCATCCAGGTGTACCTATTCGACAGCAAGCAGTACCAAAAGGGAGCCGACTTCTCCCGATATCTGGCCGAGCGA
ATCCAGTCGCTCAACCGCCGCACGCTCGACTCCCTGTCCGCCAAGGCCTTTTTCTACTACTCCCTCTTCTGCGAG
CACATTGCGCCGCTGCCGCCGTCTCCCGAGTCGCCCATCGTCGCCATCCGGCCGACGCTGCTCGCGGCCCTCCGG
ACTGCCGTACTGCGCAAGGACATTGACACGCAGGCCTCGGTCATCGTCCTCCTCCTGCGTAATTACCTGCTGACG
TCGCACATCAACCAGGCCGACCTGCTCGTCTCGCACACGCAGTTTCCGGAGAACGCCGTCAACAACCAGGTGGCC
CGGTTCCTGTACTACCTCGGCAGGATCAAGGCGATCCAGCTTCGGTACACGGAGGCGCACGAGCACCTGACGGCG
GCCACGCGCAAGGCGCCCTCGAGCGGCTGCGCCGTGGGCTTCTCGCAGACGGCGACCAAGCTCCTGCTGGTGGTG
GAGCTGCTGATGGGTGACATCCCCGACCGAGCCACCTTTCGCCTGCCGTCGCTGGAGGCTGCCCTGCACCCCTAT
TTCCTACTGGTGCAGGCCGTCCGCGTCGGCAACCTCGAGGACTTTGAGACGACCATTGCCGACCACGCCGACACG
TTCCGACGCGACGGCACCTACACGCTGATCTTGCGCCTCCGACAGAACGTCATCAAGACGGGCATCCGCATGATG
TCGCTTTCGTACTCACGCATCTCACTACGTGATATATGTATTCGGCTTCATCTGGGCAGTGAGGAGTCGGCCGAG
TACATTGTGGCCAAAGCCATCCGAGATGGCGTCATCGAGGCCACGCTCGACCGAGAGCGCGGCTTCATGAAGAGC
AACGAGATTGGCGACGTTTACGCGACGAGAGAACCCGGCGAGGCGTTCCACGATCGAATCCAAGCTTGTCTCGCG
CTTCACAATGAGAGCGTCAAGGCCATGCGCTTCCCCATGAACCAACACCGTCTCGAACTTAAGAACGCCCAAGAA
GCGAGAGAGCGCGAACGAGAGATGGCCAAGGAGATACAAGAAGGGGATCTGGACGAGGACGACCTCGGCGGCGAC
TTTGAGGGCATG
Transcript >Ophio5|3244
ATGCCCGGAAAACTCCCCCCAAGCAACGGTGACCAACCGCTTGGGAACGGCGTCAGGAGCACCAACGACGATGTC
GACACGAAGGACGCCGCAAAGACCAAGGGCAAAAAGGCCGCCAAGGATGGCGACGATGAGATGACCGTAGTGCTT
CCTCCGTCCAAGGCATCCAAGCAACCCAGTCAATCGCAGGATTCTGATGGCGACGTTTCCATGACGGACGACACC
GACGCAGAAGTCAAGGTCGATCCCGCCCTCCAGGCTGTGGCAGACATCAAGAGCAATTTTGCACTGCTTGACCGT
GCCGTCGCTCTCTTCGATGCCAGATTTTCCCTCCGAGCCCTGCGTTCCATCTCTCTCATTCGCAAGCGCCTGACG
CCCGACATCATCGGGCAGGCCATCGTCGACACTTTCCCCGCCACCGTGACGTCTGGAAACATTGCCAAGCATCTC
CTGGTCGCTATCGGCCGCGAGAGCATGCCGCTCGGAAGGCAGCCTGGACCCGAGATGGAGATGGACGTCGATGGA
AAGCCGGCAAAGAACGGCGCGGCCAAGAAGGAGGTCAAGGAAATCATCCCCGAAATCGACATCTTTCTCGGCATC
CTCATCCAGGTGTACCTATTCGACAGCAAGCAGTACCAAAAGGGAGCCGACTTCTCCCGATATCTGGCCGAGCGA
ATCCAGTCGCTCAACCGCCGCACGCTCGACTCCCTGTCCGCCAAGGCCTTTTTCTACTACTCCCTCTTCTGCGAG
CACATTGCGCCGCTGCCGCCGTCTCCCGAGTCGCCCATCGTCGCCATCCGGCCGACGCTGCTCGCGGCCCTCCGG
ACTGCCGTACTGCGCAAGGACATTGACACGCAGGCCTCGGTCATCGTCCTCCTCCTGCGTAATTACCTGCTGACG
TCGCACATCAACCAGGCCGACCTGCTCGTCTCGCACACGCAGTTTCCGGAGAACGCCGTCAACAACCAGGTGGCC
CGGTTCCTGTACTACCTCGGCAGGATCAAGGCGATCCAGCTTCGGTACACGGAGGCGCACGAGCACCTGACGGCG
GCCACGCGCAAGGCGCCCTCGAGCGGCTGCGCCGTGGGCTTCTCGCAGACGGCGACCAAGCTCCTGCTGGTGGTG
GAGCTGCTGATGGGTGACATCCCCGACCGAGCCACCTTTCGCCTGCCGTCGCTGGAGGCTGCCCTGCACCCCTAT
TTCCTACTGGTGCAGGCCGTCCGCGTCGGCAACCTCGAGGACTTTGAGACGACCATTGCCGACCACGCCGACACG
TTCCGACGCGACGGCACCTACACGCTGATCTTGCGCCTCCGACAGAACGTCATCAAGACGGGCATCCGCATGATG
TCGCTTTCGTACTCACGCATCTCACTACGTGATATATGTATTCGGCTTCATCTGGGCAGTGAGGAGTCGGCCGAG
TACATTGTGGCCAAAGCCATCCGAGATGGCGTCATCGAGGCCACGCTCGACCGAGAGCGCGGCTTCATGAAGAGC
AACGAGATTGGCGACGTTTACGCGACGAGAGAACCCGGCGAGGCGTTCCACGATCGAATCCAAGCTTGTCTCGCG
CTTCACAATGAGAGCGTCAAGGCCATGCGCTTCCCCATGAACCAACACCGTCTCGAACTTAAGAACGCCCAAGAA
GCGAGAGAGCGCGAACGAGAGATGGCCAAGGAGATACAAGAAGGGGATCTGGACGAGGACGACCTCGGCGGCGAC
TTTGAGGGCATGTAG
Gene >Ophio5|3244
ATGCCCGGAAAACTCCCCCCAAGCAACGGTGACCAACCGCTTGGGAACGGCGTCAGGAGCACCAACGACGATGTC
GACACGAAGGACGCCGCAAAGACCAAGGGCAAAAAGGCCGCCAAGGATGGCGACGATGAGATGACCGTAGTGCTT
CCTCCGTCCAAGGCATCCAAGCAACCCAGTCAATCGCAGGATTCTGATGGCGACGTTTCCATGACGGACGACACC
GACGCAGAAGTCAAGGTCGATCCCGCCCTCCAGGCTGTGGCAGGTATGCCGGCAGACGCCACCACCCTTCCCTCT
CCTACCTTGAGTCCGTGGCTGACTCGCCGTCGCAGACATCAAGAGCAATTTTGCACTGCTTGACCGTGCCGTCGC
TCTCTTCGATGCCAGATTTTCCCTCCGAGCCCTGCGTTCCATCTCTCTCATTCGCAAGCGCCTGACGCCCGACAT
CATCGGGCAGGCCATCGTCGACACTTTCCCCGCCACCGTGACGTCTGGAAACATTGCCAAGCATCTCCTGGTCGC
TATCGGCCGCGAGAGCATGCCGCTCGGAAGGCAGCCTGGACCCGAGATGGAGATGGACGTCGATGGAAAGCCGGC
AAAGAACGGCGCGGCCAAGAAGGAGGTCAAGGAAATCATCCCCGAAATCGACATCTTTCTCGGCATCCTCATCCA
GGTGTACCTATTCGACAGCAAGCAGTACCAAAAGGGAGCCGACTTCTCCCGATATCTGGCCGAGCGAATCCAGTC
GCTCAACCGCCGCACGCTCGACTCCCTGTCCGCCAAGGCCTTTTTCTACTACTCCCTCTTCTGCGAGCACATTGC
GCCGCTGCCGCCGTCTCCCGAGTCGCCCATCGTCGCCATCCGGCCGACGCTGCTCGCGGCCCTCCGGACTGCCGT
ACTGCGCAAGGACATTGACACGCAGGCCTCGGTCATCGTCCTCCTCCTGCGTAATTACCTGCTGACGTCGCACAT
CAACCAGGCCGACCTGCTCGTCTCGCACACGCAGTTTCCGGAGAACGCCGTCAACAACCAGGTGGCCCGGTTCCT
GTACTACCTCGGCAGGATCAAGGCGATCCAGCTTCGGTACACGGAGGCGCACGAGCACCTGACGGCGGCCACGCG
CAAGGCGCCCTCGAGCGGCTGCGCCGTGGGCTTCTCGCAGACGGCGACCAAGCTCCTGCTGGTGGTGGAGCTGCT
GATGGGTGACATCCCCGACCGAGCCACCTTTCGCCTGCCGTCGCTGGAGGCTGCCCTGCACCCCTATTTCCTACT
GGTGCAGGCCGTCCGCGTCGGCAACCTCGAGGACTTTGAGACGACCATTGCCGACCACGCCGACACGTTCCGACG
CGACGGCACCTACACGCTGATCTTGCGCCTCCGACAGAACGTCATCAAGACGGGCATCCGCATGATGTCGCTTTC
GTACTCACGCATCTCACTACGTGATATATGTATTCGGCTTCATCTGGGCAGTGAGGAGTCGGCCGAGTACATTGT
GGCCAAAGCCATCCGAGATGGCGTCATCGAGGCCACGCTCGACCGAGAGCGCGGCTTCATGAAGAGCAACGAGAT
TGGCGACGTTTACGCGACGAGAGAACCCGGCGAGGCGTTCCACGATCGAATCCAAGCTTGTCTCGCGCTTCACAA
TGAGAGCGTCAAGGTGAATCCTTTGCATGACGTCTCGTCTTTGGTCCTTTCTCTAACCCTGGAGCTCTTCCAACC
TGCAGGCCATGCGCTTCCCCATGAACCAACACCGTCTCGAACTTAAGAACGCCCAAGAAGCGAGAGAGCGCGAAC
GAGAGATGGCCAAGGAGATACAAGAAGGGGATCTGGACGAGGACGACCTCGGCGGCGACTTTGAGGGCATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail