Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3240
Gene name
Locationscaffold_257:21768..23505
Strand+
Gene length (bp)1737
Transcript length (bp)1662
Coding sequence length (bp)1659
Protein length (aa) 553

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 1.2E-09 28 196

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4078 0.9071 0.1768 0.0174 0.1006 0.0055 0.0302 0.0677 0.0295 0.0084

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5083
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|04139
Ophiocordyceps camponoti-rufipedis Ophun1|1208
Ophiocordyceps kimflemingae Ophio5|3240 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2982
Ophiocordyceps subramaniannii Hirsu2|405

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3240
MSLWLLRPEGVGAGPLLRRQHEALPQVVYRGDSRSPEVIKAEGGFHPLGEYWNNETAFSLDNHLFVNEEFLNSVW
DELCHEENGTTISSPPQLDANYATAYVSTTASPQEAVEFSNGGWVYVIQATPNMLALQEDLFDEVLALGGIRWTQ
IRGYSRVRDHGTRPSFVDLVHDGHYILNPDFDQSRWGALTASDVPDSWDHHHPSQSALDFMQSVGASVAWTGRFP
LLPSPPRASRPETTRVEASDLPGTSRQLPDDDDDDACRTRRLTCSALRRPSLLQVDDGSYTYTSDSDPDSDMQEP
QRKKSRVDIHMMDHLPTSETRQQHSDAAQAAIPEPVRRRIEQGMQTDDDCSLILSQLAAMFPTLLHHSNMMWKRW
QGGVCERLFARMPRTYLSRLWEGEEGSSRGKCPPSPCRKINKLEIDVKISPNFLAGTWDTILAGVAGRSPHLFIA
KEPKAGFQTRKAFNLKQIFTSDQVPLREIDRISLIDVAKPSVMERDQWTLEGVTLRAQCVGSSHIIQVDRYRRLG
RNLQHGNSWGPQVVWADMIQISDWHLLP
Coding >Ophio5|3240
ATGTCTCTCTGGCTGCTCCGTCCCGAGGGTGTCGGCGCCGGTCCTCTACTGCGACGACAGCATGAAGCTCTGCCC
CAGGTCGTCTACCGCGGAGACTCGAGATCGCCCGAGGTGATTAAAGCCGAGGGCGGATTTCACCCCTTGGGCGAG
TACTGGAATAACGAGACGGCATTTAGTCTCGACAACCACCTGTTCGTAAACGAGGAATTTCTAAACTCCGTCTGG
GACGAGTTGTGCCATGAAGAAAACGGCACGACCATCTCTTCCCCGCCACAACTGGACGCCAACTACGCAACCGCC
TATGTGTCGACGACGGCTTCGCCACAAGAGGCAGTCGAGTTCTCCAACGGAGGTTGGGTATATGTCATTCAAGCC
ACGCCAAACATGCTGGCCTTGCAAGAGGATCTCTTCGATGAGGTCTTGGCTTTGGGCGGTATCCGGTGGACGCAG
ATTCGGGGTTACAGCCGGGTGAGGGACCACGGGACGAGGCCTTCTTTTGTCGACCTCGTCCATGACGGCCACTAC
ATCCTCAACCCGGATTTCGACCAGAGTAGATGGGGAGCGCTGACGGCGAGCGACGTCCCGGATAGCTGGGATCAT
CATCATCCGTCACAGTCGGCTCTCGACTTTATGCAGTCTGTAGGAGCTTCTGTAGCTTGGACCGGACGCTTCCCA
CTGCTTCCCTCGCCGCCGAGGGCCAGCAGACCCGAGACGACGAGAGTTGAGGCGAGCGATTTGCCGGGCACATCA
CGGCAGCTTCCGGATGATGATGATGATGATGCATGCCGGACTCGTCGTCTGACGTGTTCGGCTCTGCGCCGTCCA
TCATTACTACAGGTGGACGACGGCTCCTACACCTACACCTCGGACTCGGACCCGGACTCGGACATGCAAGAGCCG
CAGCGTAAGAAATCAAGGGTCGACATACACATGATGGACCACCTTCCCACAAGCGAAACAAGGCAACAACACAGT
GATGCAGCACAAGCCGCCATCCCGGAGCCGGTACGACGGCGTATAGAGCAGGGCATGCAAACCGACGACGACTGC
AGTTTGATACTCTCGCAACTGGCAGCCATGTTCCCGACCCTCCTCCACCACTCCAACATGATGTGGAAACGATGG
CAAGGTGGCGTGTGCGAACGACTCTTTGCCAGGATGCCACGCACATACCTCTCACGCCTATGGGAAGGGGAAGAA
GGCTCATCACGAGGGAAATGTCCCCCTTCCCCTTGCAGAAAGATCAACAAGCTCGAAATCGACGTTAAAATCTCT
CCCAACTTCCTCGCCGGCACATGGGATACCATCCTAGCCGGCGTGGCGGGAAGAAGTCCGCATTTGTTCATCGCC
AAGGAGCCCAAGGCAGGCTTTCAGACTCGGAAAGCCTTCAACCTCAAGCAGATCTTCACCTCGGACCAAGTTCCC
CTGCGAGAAATCGATCGTATCAGCCTGATTGATGTAGCCAAGCCGAGTGTGATGGAGAGGGATCAATGGACGCTG
GAAGGTGTCACGCTACGGGCACAATGCGTCGGCTCTTCCCACATCATTCAAGTGGATCGATATCGCAGACTGGGC
CGCAATCTGCAACATGGCAACAGCTGGGGACCGCAGGTTGTCTGGGCCGACATGATACAGATCAGTGACTGGCAT
CTGCTTCCT
Transcript >Ophio5|3240
ATGTCTCTCTGGCTGCTCCGTCCCGAGGGTGTCGGCGCCGGTCCTCTACTGCGACGACAGCATGAAGCTCTGCCC
CAGGTCGTCTACCGCGGAGACTCGAGATCGCCCGAGGTGATTAAAGCCGAGGGCGGATTTCACCCCTTGGGCGAG
TACTGGAATAACGAGACGGCATTTAGTCTCGACAACCACCTGTTCGTAAACGAGGAATTTCTAAACTCCGTCTGG
GACGAGTTGTGCCATGAAGAAAACGGCACGACCATCTCTTCCCCGCCACAACTGGACGCCAACTACGCAACCGCC
TATGTGTCGACGACGGCTTCGCCACAAGAGGCAGTCGAGTTCTCCAACGGAGGTTGGGTATATGTCATTCAAGCC
ACGCCAAACATGCTGGCCTTGCAAGAGGATCTCTTCGATGAGGTCTTGGCTTTGGGCGGTATCCGGTGGACGCAG
ATTCGGGGTTACAGCCGGGTGAGGGACCACGGGACGAGGCCTTCTTTTGTCGACCTCGTCCATGACGGCCACTAC
ATCCTCAACCCGGATTTCGACCAGAGTAGATGGGGAGCGCTGACGGCGAGCGACGTCCCGGATAGCTGGGATCAT
CATCATCCGTCACAGTCGGCTCTCGACTTTATGCAGTCTGTAGGAGCTTCTGTAGCTTGGACCGGACGCTTCCCA
CTGCTTCCCTCGCCGCCGAGGGCCAGCAGACCCGAGACGACGAGAGTTGAGGCGAGCGATTTGCCGGGCACATCA
CGGCAGCTTCCGGATGATGATGATGATGATGCATGCCGGACTCGTCGTCTGACGTGTTCGGCTCTGCGCCGTCCA
TCATTACTACAGGTGGACGACGGCTCCTACACCTACACCTCGGACTCGGACCCGGACTCGGACATGCAAGAGCCG
CAGCGTAAGAAATCAAGGGTCGACATACACATGATGGACCACCTTCCCACAAGCGAAACAAGGCAACAACACAGT
GATGCAGCACAAGCCGCCATCCCGGAGCCGGTACGACGGCGTATAGAGCAGGGCATGCAAACCGACGACGACTGC
AGTTTGATACTCTCGCAACTGGCAGCCATGTTCCCGACCCTCCTCCACCACTCCAACATGATGTGGAAACGATGG
CAAGGTGGCGTGTGCGAACGACTCTTTGCCAGGATGCCACGCACATACCTCTCACGCCTATGGGAAGGGGAAGAA
GGCTCATCACGAGGGAAATGTCCCCCTTCCCCTTGCAGAAAGATCAACAAGCTCGAAATCGACGTTAAAATCTCT
CCCAACTTCCTCGCCGGCACATGGGATACCATCCTAGCCGGCGTGGCGGGAAGAAGTCCGCATTTGTTCATCGCC
AAGGAGCCCAAGGCAGGCTTTCAGACTCGGAAAGCCTTCAACCTCAAGCAGATCTTCACCTCGGACCAAGTTCCC
CTGCGAGAAATCGATCGTATCAGCCTGATTGATGTAGCCAAGCCGAGTGTGATGGAGAGGGATCAATGGACGCTG
GAAGGTGTCACGCTACGGGCACAATGCGTCGGCTCTTCCCACATCATTCAAGTGGATCGATATCGCAGACTGGGC
CGCAATCTGCAACATGGCAACAGCTGGGGACCGCAGGTTGTCTGGGCCGACATGATACAGATCAGTGACTGGCAT
CTGCTTCCTTGA
Gene >Ophio5|3240
ATGTCTCTCTGGCTGCTCCGTCCCGAGGGTGTCGGCGCCGGTCCTCTACTGCGACGACAGCATGAAGCTCTGCCC
CAGGTCGTCTACCGCGGAGACTCGAGATCGCCCGAGGTGATTAAAGCCGAGGGCGGATTTCACCCCTTGGGCGAG
TACTGGAATAACGAGACGGCATTTAGTCTCGACAACCACCTGTTCGTAAACGAGGAATTTCTAAACTCCGTCTGG
GACGAGTTGTGCCATGAAGAAAACGGCACGACCATCTCTTCCCCGCCACAACTGGACGCCAACTACGCAACCGCC
TATGTGTCGACGACGGCTTCGCCACAAGAGGCAGTCGAGTTCTCCAACGGAGGTTGGGTATATGTCATTCAAGCC
ACGCCAAACATGCTGGCCTTGCAAGAGGATCTCTTCGATGAGGTCTTGGCTTTGGGCGGTATCCGGTGGACGCAG
ATTCGGGGTTACAGCCGGGTGAGGGACCACGGGACGAGGCCTTCTTTTGTCGACCTCGTCCATGACGGCCACTAC
ATCCTCAACCCGGATTTCGACCAGAGTAGATGGGGAGCGCTGACGGCGAGCGACGTCCCGGATAGCTGGGATCAT
CATCATCCGTCACAGTCGGCTCTCGACTTTATGCAGTCTGTAGGAGCTTCTGTAGCTTGGACCGGACGCTTCCCA
CTGCTTCCCTCGCCGCCGAGGGCCAGCAGACCCGAGACGACGAGAGTTGAGGCGAGCGATTTGCCGGGCACATCA
CGGCAGCTTCCGGATGATGATGATGATGATGCATGCCGGACTCGTCGTCTGACGTGTTCGGCTCTGCGCCGTCCA
TCATTACTACAGGTGGACGACGGCTCCTACACCTACACCTCGGACTCGGACCCGGACTCGGACATGCAAGAGCCG
CAGCGTAAGAAATCAAGGGTCGACATACACATGATGGACCACCTTCCCACAAGCGAAACAAGGCAACAACACAGT
GATGCAGCACAAGCCGCCATCCCGGAGCCGGTACGACGGCGTATAGAGCAGGGCATGCAAACCGACGACGACTGC
AGTTTGATACTCTCGCAACTGGCAGCCATGTTCCCGACCCTCCTCCACCACTCCAACATGATGTGGAAACGATGG
CAAGGTGGCGTGTGCGAACGACTCTTTGCCAGGATGCCACGCACATACCTCTCACGCCTATGGGAAGGGGAAGAA
GGCTCATCACGAGGGAAATGTCCCCCTTCCCCTTGCAGAAAGATCAACAAGCTCGAAATCGACGTTAAAATCTCT
CCCAACTTCCTCGCCGGCACATGGGATACCATCCTAGCCGGCGTGGCGGGAAGAAGTCCGCATTTGTTCATCGCC
AAGGAGCCCAAGGCAGGCTTTCAGACTCGGAAAGCCTTCAACCTCAAGCAGATCTTCACCTCGGACCAAGTTCCC
CTGCGAGAAATCGATCGTATCAGCCTGATTGATGTAGCCAAGCCGAGTGTGATGGAGAGGGATCAATGGACGCTG
GAAGGTAGGTACATACATGAATTGTCCATTCATTCACCATTCCCACCACTCATCCTAACTAACCTCTTCCTACTC
TCAGGTGTCACGCTACGGGCACAATGCGTCGGCTCTTCCCACATCATTCAAGTGGATCGATATCGCAGACTGGGC
CGCAATCTGCAACATGGCAACAGCTGGGGACCGCAGGTTGTCTGGGCCGACATGATACAGATCAGTGACTGGCAT
CTGCTTCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail