Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3234
Gene name
Locationscaffold_257:1185..1905
Strand+
Gene length (bp)720
Transcript length (bp)510
Coding sequence length (bp)507
Protein length (aa) 169

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 95 117 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 148.50 78.08 218.92
CcL In ants, during behavior modification 118.85 58.78 178.91
CcD In ants, recently dead 132.81 68.43 197.19

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.386610 no
SC16a CcD 0.686095 no
CcL CcD 0.698656 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3234
MEDLRLSSLHALRANFSAANSHHLARCWSHQDCSGCLDDAECSWCPFTWACVPNACPIPLLAPAYDAQICPHPAE
RWELRTQPFGCRVSTTTSLTAVATVLATGIVALVTLLNIVALRRWRRRALHKPDWRDGPDYCWRAVLLAPDARER
QPLLGDPAADGSTNRVSEA
Coding >Ophio5|3234
ATGGAGGATTTGCGTCTTTCGTCCCTGCACGCCTTGCGCGCCAACTTCTCCGCTGCCAATAGTCACCACCTCGCG
CGATGCTGGTCTCATCAGGACTGCAGTGGCTGCTTGGATGACGCTGAATGCAGCTGGTGTCCCTTTACTTGGGCC
TGTGTCCCAAACGCCTGCCCGATTCCGCTCCTTGCTCCGGCATACGATGCCCAAATTTGTCCTCATCCGGCCGAG
CGATGGGAACTCCGCACTCAACCCTTTGGCTGTCGCGTCTCGACCACCACCAGCCTGACCGCCGTCGCAACCGTC
TTGGCTACTGGTATCGTGGCCCTCGTCACCCTGCTCAATATCGTTGCTCTCCGCCGATGGCGCCGTCGCGCCCTC
CACAAGCCCGATTGGCGTGACGGCCCCGACTACTGCTGGCGCGCCGTCCTGCTGGCCCCGGACGCCCGCGAGCGA
CAACCGCTCCTTGGAGACCCGGCAGCTGACGGGAGCACGAATCGAGTATCTGAGGCG
Transcript >Ophio5|3234
ATGGAGGATTTGCGTCTTTCGTCCCTGCACGCCTTGCGCGCCAACTTCTCCGCTGCCAATAGTCACCACCTCGCG
CGATGCTGGTCTCATCAGGACTGCAGTGGCTGCTTGGATGACGCTGAATGCAGCTGGTGTCCCTTTACTTGGGCC
TGTGTCCCAAACGCCTGCCCGATTCCGCTCCTTGCTCCGGCATACGATGCCCAAATTTGTCCTCATCCGGCCGAG
CGATGGGAACTCCGCACTCAACCCTTTGGCTGTCGCGTCTCGACCACCACCAGCCTGACCGCCGTCGCAACCGTC
TTGGCTACTGGTATCGTGGCCCTCGTCACCCTGCTCAATATCGTTGCTCTCCGCCGATGGCGCCGTCGCGCCCTC
CACAAGCCCGATTGGCGTGACGGCCCCGACTACTGCTGGCGCGCCGTCCTGCTGGCCCCGGACGCCCGCGAGCGA
CAACCGCTCCTTGGAGACCCGGCAGCTGACGGGAGCACGAATCGAGTATCTGAGGCGTGA
Gene >Ophio5|3234
ATGGAGGATTTGCGTCTTTCGTCCCTGCACGCCTTGCGCGCCAACTTCTCCGCTGCCAATAGTCACCACCTCGCG
CGATGCTGGTCTCATCAGGACTGCAGTGGCTGCTTGGATGACGCTGAATGCAGCTGGTGTCCCTTTGTCCGCATA
TCCTGCCCTCTACGCTTCCCCCCCCTTGCTGATCGTGTGTGCAGACTTGGGCCTGTGTCCCAAACGCCTGCCCGA
TTCCGCTCCTTGCTCCGGCATACGATGCCCAAATTTGTCCTCATCCGGCCGAGCGATGGGAACTCCGCACTCAAC
CCTTTGGCTGTCGCGTCTCGACCACCACCAGCCTGACCGCCGTCGCAACCGTCTTGGCTACTGGTATCGTGGCCC
TCGTCACCCTGCTCAATATCGTTGCTCTCCGCCGATGGCGCCGTCGCGCCCTCCACAAGCCCGATTGGCGTGACG
GCCCCGACTACTGCTGGCGCGCCGTCCTGCTGGCCCCGGACGCCCGCGAGCGACAACCGCTCCTTGGAGACCCGG
CAGGTCGCTGACGCCGTACGTCGACTCCAGTACCTGACCGTTTTCATCGCAACCATTCTTGCCATCACCCGGAGC
TGACGGGAGGTATGATGGCGACCTCATCCACTGCCAAGATGATTTGATCCCCGTCCTTTGGCACGTCTACGTACT
GCATATTGACCGTTACCAAGCACGAATCGAGTATCTGAGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail