Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3223
Gene name
Locationscaffold_255:7294..7854
Strand+
Gene length (bp)560
Transcript length (bp)495
Coding sequence length (bp)492
Protein length (aa) 164

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.8237 0.5497 0.0789 0.1773 0.1197 0.0131 0.1013 0.1718 0.1056 0.0054

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2484
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5737
Ophiocordyceps australis map64 (Brazil) OphauB2|2241
Ophiocordyceps camponoti-floridani Ophcf2|05098
Ophiocordyceps camponoti-rufipedis Ophun1|3269
Ophiocordyceps kimflemingae Ophio5|3223 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3586

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3223
MASASAAAPDRVSVSAWSSRYRGATVQDLEPPAALSLNPSDAISVALMSAFERDYTHLTVVDSDTRALLGYISIP
HLQSLLDAGRVQPKDPLSAAMTRFQRRGKAYRVITMETPLEHLEDFFRQGVPGGAWRQDFAVITDENRRFVLGVA
TVQDLEEFVKRRPA
Coding >Ophio5|3223
ATGGCCTCGGCATCGGCTGCCGCGCCCGATCGGGTGTCTGTCTCGGCCTGGTCATCGCGCTATCGCGGGGCCACC
GTCCAAGATCTCGAACCGCCGGCCGCGCTGTCTTTAAACCCCTCTGACGCCATTTCCGTCGCCCTCATGTCCGCT
TTCGAGCGCGACTACACTCATCTTACCGTCGTCGATTCCGACACGCGCGCCCTCCTGGGATACATTTCCATCCCC
CATCTGCAATCCCTCCTCGACGCCGGTCGCGTGCAGCCGAAGGACCCCCTCAGCGCCGCCATGACGCGCTTCCAG
CGCCGAGGTAAGGCCTACCGTGTCATCACCATGGAGACACCTCTCGAGCATCTCGAGGACTTCTTTCGCCAAGGC
GTCCCGGGTGGAGCCTGGCGCCAGGACTTTGCCGTCATCACCGACGAAAACCGACGCTTCGTACTCGGCGTCGCC
ACCGTTCAGGACTTGGAAGAGTTTGTCAAGAGGAGGCCCGCG
Transcript >Ophio5|3223
ATGGCCTCGGCATCGGCTGCCGCGCCCGATCGGGTGTCTGTCTCGGCCTGGTCATCGCGCTATCGCGGGGCCACC
GTCCAAGATCTCGAACCGCCGGCCGCGCTGTCTTTAAACCCCTCTGACGCCATTTCCGTCGCCCTCATGTCCGCT
TTCGAGCGCGACTACACTCATCTTACCGTCGTCGATTCCGACACGCGCGCCCTCCTGGGATACATTTCCATCCCC
CATCTGCAATCCCTCCTCGACGCCGGTCGCGTGCAGCCGAAGGACCCCCTCAGCGCCGCCATGACGCGCTTCCAG
CGCCGAGGTAAGGCCTACCGTGTCATCACCATGGAGACACCTCTCGAGCATCTCGAGGACTTCTTTCGCCAAGGC
GTCCCGGGTGGAGCCTGGCGCCAGGACTTTGCCGTCATCACCGACGAAAACCGACGCTTCGTACTCGGCGTCGCC
ACCGTTCAGGACTTGGAAGAGTTTGTCAAGAGGAGGCCCGCGTGA
Gene >Ophio5|3223
ATGGCCTCGGCATCGGCTGCCGCGCCCGATCGGGTGTCTGTCTCGGCCTGGTCATCGCGCTATCGCGGGGTAAAA
GGATTTTGCCTCGTTTCATCGTGAAGCGGCTGGCTGACCTTGGTACTCTCTCTCGCCAGGCCACCGTCCAAGATC
TCGAACCGCCGGCCGCGCTGTCTTTAAACCCCTCTGACGCCATTTCCGTCGCCCTCATGTCCGCTTTCGAGCGCG
ACTACACTCATCTTACCGTCGTCGATTCCGACACGCGCGCCCTCCTGGGATACATTTCCATCCCCCATCTGCAAT
CCCTCCTCGACGCCGGTCGCGTGCAGCCGAAGGACCCCCTCAGCGCCGCCATGACGCGCTTCCAGCGCCGAGGTA
AGGCCTACCGTGTCATCACCATGGAGACACCTCTCGAGCATCTCGAGGACTTCTTTCGCCAAGGCGTCCCGGGTG
GAGCCTGGCGCCAGGACTTTGCCGTCATCACCGACGAAAACCGACGCTTCGTACTCGGCGTCGCCACCGTTCAGG
ACTTGGAAGAGTTTGTCAAGAGGAGGCCCGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail