Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3219
Gene name
Locationscaffold_255:263..718
Strand+
Gene length (bp)455
Transcript length (bp)252
Coding sequence length (bp)249
Protein length (aa) 83

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08571 Yos1 Yos1-like 6.0E-31 4 83

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13825|YOS1_SCHPO Protein transport protein yos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yos1 PE=3 SV=1 1 83 2.0E-16
sp|Q3E834|YOS1_YEAST Protein transport protein YOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOS1 PE=1 SV=1 4 83 4.0E-14
sp|Q4VBI2|IR3IP_DANRE Immediate early response 3-interacting protein 1 OS=Danio rerio GN=ier3ip1 PE=3 SV=1 7 83 4.0E-10
sp|Q3B8G7|IR3IP_XENLA Immediate early response 3-interacting protein 1 OS=Xenopus laevis GN=ier3ip1 PE=3 SV=1 11 83 6.0E-10
sp|P85007|IR3IP_RAT Immediate early response 3-interacting protein 1 OS=Rattus norvegicus GN=Ier3ip1 PE=3 SV=1 11 83 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13825|YOS1_SCHPO Protein transport protein yos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yos1 PE=3 SV=1 1 83 2.0E-16
sp|Q3E834|YOS1_YEAST Protein transport protein YOS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOS1 PE=1 SV=1 4 83 4.0E-14
sp|Q4VBI2|IR3IP_DANRE Immediate early response 3-interacting protein 1 OS=Danio rerio GN=ier3ip1 PE=3 SV=1 7 83 4.0E-10
sp|Q3B8G7|IR3IP_XENLA Immediate early response 3-interacting protein 1 OS=Xenopus laevis GN=ier3ip1 PE=3 SV=1 11 83 6.0E-10
sp|P85007|IR3IP_RAT Immediate early response 3-interacting protein 1 OS=Rattus norvegicus GN=Ier3ip1 PE=3 SV=1 11 83 1.0E-08
sp|Q9CR20|IR3IP_MOUSE Immediate early response 3-interacting protein 1 OS=Mus musculus GN=Ier3ip1 PE=3 SV=1 11 83 1.0E-08
sp|Q9Y5U9|IR3IP_HUMAN Immediate early response 3-interacting protein 1 OS=Homo sapiens GN=IER3IP1 PE=1 SV=1 11 83 2.0E-08
sp|Q1JQC2|IR3IP_BOVIN Immediate early response 3-interacting protein 1 OS=Bos taurus GN=IER3IP1 PE=3 SV=1 11 83 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 2 21 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3219
MLFFGNFVYIAILLINAVAILSEDRFLARINLSPASYDPAFGIGADASMKAKIINIIASVRTTMRPILIFLNTTI
ILYEIVLG
Coding >Ophio5|3219
ATGCTCTTCTTCGGCAACTTTGTCTACATCGCCATCCTCCTCATCAATGCTGTCGCCATCCTCAGCGAGGACCGC
TTCCTCGCTCGCATAAACCTCTCGCCCGCTTCGTACGATCCGGCCTTTGGAATCGGTGCCGACGCGAGCATGAAG
GCCAAGATCATTAACATCATTGCCAGCGTCCGCACCACCATGCGCCCGATACTCATCTTCTTGAACACCACCATC
ATACTGTACGAGATCGTCCTCGGC
Transcript >Ophio5|3219
ATGCTCTTCTTCGGCAACTTTGTCTACATCGCCATCCTCCTCATCAATGCTGTCGCCATCCTCAGCGAGGACCGC
TTCCTCGCTCGCATAAACCTCTCGCCCGCTTCGTACGATCCGGCCTTTGGAATCGGTGCCGACGCGAGCATGAAG
GCCAAGATCATTAACATCATTGCCAGCGTCCGCACCACCATGCGCCCGATACTCATCTTCTTGAACACCACCATC
ATACTGTACGAGATCGTCCTCGGCTGA
Gene >Ophio5|3219
ATGCTCTTCTTCGGCAACTTTGTCTACATCGCCATCCTCCTCATCAATGCTGTCGCCATCCTCAGCGAGGACCGC
TTCCTCGCTCGCAGTCCGTCCTCTCTCCTGAGTGCGCCTTTCGCCGGCCTGCTGACCCGCTCCCCCTTTTTTTTC
TTCTTTTTTCTTCGCTCGGCAGTAAACCTCTCGCCCGCTTCGTACGATCCGGCCTTTGGAATCGGTGCCGACGCG
AGCATGAAGGCCAAGATCATTAACATCATTGCCAGCGTCCGCACCACCATGCGCCGTGCGTTCGTCCCTCTTTGA
TCATCTTCTGCGCATGACTACCACCCTCATCTCTCTGCTCGTCTTGTCTTCCTCCTCGGCCTCGAGTCGCTCGCT
AATTCCTTCGCCCCATCGTTGCAGCGATACTCATCTTCTTGAACACCACCATCATACTGTACGAGATCGTCCTCG
GCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail