Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3216
Gene name
Locationscaffold_254:16311..17487
Strand-
Gene length (bp)1176
Transcript length (bp)1176
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AK17|PLCX1_ARTBC PI-PLC X domain-containing protein 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04618 PE=1 SV=1 41 347 2.0E-45
sp|D4AUX6|A8043_ARTBC Uncharacterized secreted protein ARB_08043 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_08043 PE=1 SV=1 42 334 3.0E-44

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3216
MPSLRAVVTALATVVVVAVQAAPQAAAGSDPGSGSGSGSGVCNNSPSLCSRPYNKMTHLGAHDSSFLRDKSTNNS
PAGNQFKNATLALDAGLRLLQTQLHKVESGQTPQERLRLCHSSCGILDAGPLERWLAAVTDWMSRNPNDVVTLLL
VNSDRVPAQDIGAAFERAGLAQLAYKPPPAANTQSTWPTLQTMISQGTRVVVFVTNMPTAPDVPYLIPEFEHIFE
TAFEITQLDGFNCTLDRPKSAGDAAAALGAGYMSLVNHFKYQNVGIGLLKSLASSVGINSNIIMPDADRAGVVNS
PAQTADGNLGRHVEQCRSQWGQPPNFVLVDFWDVAGPLDAIDTLNGMPVGAASGRKAVAPGPVTAAARRSRGVVA
AVTLAAMAAASTLVLM
Coding >Ophio5|3216
ATGCCGTCGTTGCGCGCCGTCGTCACGGCTCTGGCAACCGTCGTTGTTGTCGCCGTTCAAGCGGCTCCACAGGCG
GCGGCCGGCTCCGATCCCGGCTCCGGCTCCGGCTCCGGCTCCGGCGTGTGCAACAACTCGCCATCGCTATGCAGC
CGCCCTTACAACAAGATGACGCATCTCGGCGCGCACGACAGCTCCTTTCTGCGCGACAAGAGCACCAACAACTCG
CCGGCCGGCAACCAGTTCAAGAACGCGACACTGGCGCTCGACGCCGGCCTCCGTCTGCTGCAGACGCAGCTCCAC
AAGGTCGAGTCCGGGCAGACGCCCCAGGAGCGGCTCCGGCTGTGCCATTCGTCATGCGGCATCCTCGACGCCGGA
CCGCTGGAACGATGGCTCGCGGCCGTGACCGACTGGATGAGCCGCAATCCCAACGACGTGGTGACGCTACTGCTC
GTCAACTCGGACCGCGTCCCGGCTCAGGATATTGGCGCCGCCTTTGAGCGCGCCGGCCTCGCTCAGCTGGCTTAT
AAGCCCCCGCCGGCGGCCAATACGCAATCGACGTGGCCGACTCTGCAGACCATGATCAGTCAGGGCACCCGCGTC
GTCGTCTTCGTCACCAACATGCCGACGGCTCCCGACGTGCCGTACCTGATACCCGAGTTCGAGCACATCTTCGAG
ACGGCCTTTGAGATTACCCAGCTCGACGGCTTCAACTGCACCCTCGACCGGCCCAAGAGCGCCGGTGACGCCGCC
GCCGCTCTCGGTGCCGGCTACATGAGCCTCGTCAACCACTTCAAGTACCAGAACGTCGGCATCGGCCTCCTCAAG
AGCCTGGCCAGCAGCGTCGGCATCAACTCCAACATCATCATGCCGGACGCGGACCGGGCGGGCGTCGTCAACAGC
CCCGCCCAGACGGCGGACGGAAACCTGGGGAGACACGTCGAGCAGTGTCGGTCACAATGGGGGCAGCCGCCTAAC
TTTGTCCTGGTCGACTTCTGGGACGTTGCTGGACCGCTGGACGCCATCGACACGCTCAATGGAATGCCGGTTGGA
GCCGCGTCTGGGCGAAAGGCTGTTGCTCCGGGGCCTGTGACTGCTGCTGCGAGGCGCTCGAGGGGAGTCGTGGCC
GCGGTTACGTTGGCTGCGATGGCGGCTGCGTCGACGCTGGTGTTGATG
Transcript >Ophio5|3216
ATGCCGTCGTTGCGCGCCGTCGTCACGGCTCTGGCAACCGTCGTTGTTGTCGCCGTTCAAGCGGCTCCACAGGCG
GCGGCCGGCTCCGATCCCGGCTCCGGCTCCGGCTCCGGCTCCGGCGTGTGCAACAACTCGCCATCGCTATGCAGC
CGCCCTTACAACAAGATGACGCATCTCGGCGCGCACGACAGCTCCTTTCTGCGCGACAAGAGCACCAACAACTCG
CCGGCCGGCAACCAGTTCAAGAACGCGACACTGGCGCTCGACGCCGGCCTCCGTCTGCTGCAGACGCAGCTCCAC
AAGGTCGAGTCCGGGCAGACGCCCCAGGAGCGGCTCCGGCTGTGCCATTCGTCATGCGGCATCCTCGACGCCGGA
CCGCTGGAACGATGGCTCGCGGCCGTGACCGACTGGATGAGCCGCAATCCCAACGACGTGGTGACGCTACTGCTC
GTCAACTCGGACCGCGTCCCGGCTCAGGATATTGGCGCCGCCTTTGAGCGCGCCGGCCTCGCTCAGCTGGCTTAT
AAGCCCCCGCCGGCGGCCAATACGCAATCGACGTGGCCGACTCTGCAGACCATGATCAGTCAGGGCACCCGCGTC
GTCGTCTTCGTCACCAACATGCCGACGGCTCCCGACGTGCCGTACCTGATACCCGAGTTCGAGCACATCTTCGAG
ACGGCCTTTGAGATTACCCAGCTCGACGGCTTCAACTGCACCCTCGACCGGCCCAAGAGCGCCGGTGACGCCGCC
GCCGCTCTCGGTGCCGGCTACATGAGCCTCGTCAACCACTTCAAGTACCAGAACGTCGGCATCGGCCTCCTCAAG
AGCCTGGCCAGCAGCGTCGGCATCAACTCCAACATCATCATGCCGGACGCGGACCGGGCGGGCGTCGTCAACAGC
CCCGCCCAGACGGCGGACGGAAACCTGGGGAGACACGTCGAGCAGTGTCGGTCACAATGGGGGCAGCCGCCTAAC
TTTGTCCTGGTCGACTTCTGGGACGTTGCTGGACCGCTGGACGCCATCGACACGCTCAATGGAATGCCGGTTGGA
GCCGCGTCTGGGCGAAAGGCTGTTGCTCCGGGGCCTGTGACTGCTGCTGCGAGGCGCTCGAGGGGAGTCGTGGCC
GCGGTTACGTTGGCTGCGATGGCGGCTGCGTCGACGCTGGTGTTGATGTAG
Gene >Ophio5|3216
ATGCCGTCGTTGCGCGCCGTCGTCACGGCTCTGGCAACCGTCGTTGTTGTCGCCGTTCAAGCGGCTCCACAGGCG
GCGGCCGGCTCCGATCCCGGCTCCGGCTCCGGCTCCGGCTCCGGCGTGTGCAACAACTCGCCATCGCTATGCAGC
CGCCCTTACAACAAGATGACGCATCTCGGCGCGCACGACAGCTCCTTTCTGCGCGACAAGAGCACCAACAACTCG
CCGGCCGGCAACCAGTTCAAGAACGCGACACTGGCGCTCGACGCCGGCCTCCGTCTGCTGCAGACGCAGCTCCAC
AAGGTCGAGTCCGGGCAGACGCCCCAGGAGCGGCTCCGGCTGTGCCATTCGTCATGCGGCATCCTCGACGCCGGA
CCGCTGGAACGATGGCTCGCGGCCGTGACCGACTGGATGAGCCGCAATCCCAACGACGTGGTGACGCTACTGCTC
GTCAACTCGGACCGCGTCCCGGCTCAGGATATTGGCGCCGCCTTTGAGCGCGCCGGCCTCGCTCAGCTGGCTTAT
AAGCCCCCGCCGGCGGCCAATACGCAATCGACGTGGCCGACTCTGCAGACCATGATCAGTCAGGGCACCCGCGTC
GTCGTCTTCGTCACCAACATGCCGACGGCTCCCGACGTGCCGTACCTGATACCCGAGTTCGAGCACATCTTCGAG
ACGGCCTTTGAGATTACCCAGCTCGACGGCTTCAACTGCACCCTCGACCGGCCCAAGAGCGCCGGTGACGCCGCC
GCCGCTCTCGGTGCCGGCTACATGAGCCTCGTCAACCACTTCAAGTACCAGAACGTCGGCATCGGCCTCCTCAAG
AGCCTGGCCAGCAGCGTCGGCATCAACTCCAACATCATCATGCCGGACGCGGACCGGGCGGGCGTCGTCAACAGC
CCCGCCCAGACGGCGGACGGAAACCTGGGGAGACACGTCGAGCAGTGTCGGTCACAATGGGGGCAGCCGCCTAAC
TTTGTCCTGGTCGACTTCTGGGACGTTGCTGGACCGCTGGACGCCATCGACACGCTCAATGGAATGCCGGTTGGA
GCCGCGTCTGGGCGAAAGGCTGTTGCTCCGGGGCCTGTGACTGCTGCTGCGAGGCGCTCGAGGGGAGTCGTGGCC
GCGGTTACGTTGGCTGCGATGGCGGCTGCGTCGACGCTGGTGTTGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail