Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3212
Gene name
Locationscaffold_254:9965..11414
Strand-
Gene length (bp)1449
Transcript length (bp)1368
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 406 428 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 47.38 25.52 69.24
CcL In ants, during behavior modification 83.51 45.24 121.77
CcD In ants, recently dead 80.17 43.46 116.88

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.010908 yes
SC16a CcD 0.016750 yes
CcL CcD 0.888055 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3212
MTSVDEGSATGPFAATDSSLGETFRRSLLSSSLSAYSVGSSAGSSTAARRSSHISKTYRQASTLFLTRRLPEALT
TLTPLIVPGDNGEPAPVAKASRTSRIKVWSLYLTILHAVVEMNPDDGKEAFGNQDWRALCAKVRDGLVWEEVVRD
GYHGVEGDVDSDVVINLATLLLAHARDQTLNQRRLEAYLATSNTPDLDLTGQMDTSPVPRSHAGPRYRSPAPGTS
GADTPRDLNARVKILELYTLHVLLRNNEWDYAREFISVSSVLDDERREAFLQALESLQEEQQEQERLERAERRRQ
EEQLRRQIDDARRLRAENEEWERRRLDEARRTRRPSTEVDYGVQGSPTPDARLGSRPQQRTSRIPASSSGGKPAV
PRTFTARAGMILSRLRAVLDGLAASLNGNPALLARLLAFVVGLLVLVGHGGIRHRIQRVLGASWTKFKATAGMGT
KISYI
Coding >Ophio5|3212
ATGACGTCCGTCGACGAAGGCTCCGCCACCGGCCCTTTCGCCGCCACCGATTCTTCGTTGGGCGAGACCTTTCGG
CGCAGCCTGCTCTCGTCCTCCCTCTCGGCCTACTCGGTCGGATCTTCGGCCGGCTCCTCGACGGCGGCCCGCCGT
TCGTCGCACATATCCAAGACGTACCGTCAGGCCTCAACGCTCTTCCTGACCCGTCGTCTGCCCGAGGCTCTGACG
ACGCTGACTCCCCTCATCGTCCCGGGCGACAACGGCGAGCCCGCGCCCGTGGCCAAGGCCTCACGCACGTCGCGC
ATCAAGGTCTGGAGCCTTTACCTGACCATCCTCCATGCCGTCGTGGAGATGAACCCCGACGACGGTAAGGAGGCC
TTTGGCAATCAGGATTGGAGGGCTCTATGCGCCAAGGTTCGAGACGGTCTCGTCTGGGAGGAGGTCGTGCGGGAC
GGCTACCACGGCGTCGAGGGAGATGTCGACTCTGACGTCGTCATCAATCTGGCGACGCTCCTCTTGGCGCACGCG
CGCGACCAGACCTTGAACCAGCGCAGGCTCGAGGCTTACCTGGCCACGTCTAACACGCCCGACCTCGACCTGACC
GGCCAGATGGATACGTCGCCCGTTCCACGGTCCCATGCTGGGCCGCGATATCGGTCACCCGCTCCGGGCACGAGC
GGCGCCGACACGCCGCGGGATCTCAACGCCCGGGTCAAGATACTGGAGCTGTACACGCTACACGTTCTGCTGCGC
AACAACGAGTGGGACTACGCCCGCGAATTTATCAGCGTCAGCTCCGTCCTCGACGACGAGCGGCGCGAGGCCTTT
CTCCAGGCCCTCGAGAGCCTGCAAGAGGAGCAGCAGGAACAAGAGCGGTTGGAACGGGCGGAGCGCCGCCGCCAA
GAGGAGCAGCTGCGCCGCCAAATCGACGACGCGAGACGCTTGCGCGCCGAAAACGAAGAATGGGAGCGGAGACGA
CTGGACGAGGCGCGTCGGACGCGGCGTCCCAGCACAGAGGTCGACTACGGCGTCCAAGGGAGTCCGACTCCCGAT
GCCCGCCTTGGCAGCAGGCCGCAGCAGCGGACGTCGCGCATACCCGCCTCCTCATCTGGCGGTAAGCCCGCGGTG
CCCAGGACGTTTACGGCGCGCGCGGGCATGATATTGTCCCGGCTACGGGCCGTCCTCGACGGGCTCGCCGCCTCG
CTCAACGGGAATCCGGCCTTGTTGGCGAGGCTGCTCGCCTTTGTCGTCGGCCTGTTGGTCCTGGTAGGACACGGC
GGCATCAGACATCGGATACAGCGCGTGCTGGGAGCGTCTTGGACCAAGTTCAAGGCTACGGCGGGCATGGGCACC
AAGATCAGCTACATA
Transcript >Ophio5|3212
ATGACGTCCGTCGACGAAGGCTCCGCCACCGGCCCTTTCGCCGCCACCGATTCTTCGTTGGGCGAGACCTTTCGG
CGCAGCCTGCTCTCGTCCTCCCTCTCGGCCTACTCGGTCGGATCTTCGGCCGGCTCCTCGACGGCGGCCCGCCGT
TCGTCGCACATATCCAAGACGTACCGTCAGGCCTCAACGCTCTTCCTGACCCGTCGTCTGCCCGAGGCTCTGACG
ACGCTGACTCCCCTCATCGTCCCGGGCGACAACGGCGAGCCCGCGCCCGTGGCCAAGGCCTCACGCACGTCGCGC
ATCAAGGTCTGGAGCCTTTACCTGACCATCCTCCATGCCGTCGTGGAGATGAACCCCGACGACGGTAAGGAGGCC
TTTGGCAATCAGGATTGGAGGGCTCTATGCGCCAAGGTTCGAGACGGTCTCGTCTGGGAGGAGGTCGTGCGGGAC
GGCTACCACGGCGTCGAGGGAGATGTCGACTCTGACGTCGTCATCAATCTGGCGACGCTCCTCTTGGCGCACGCG
CGCGACCAGACCTTGAACCAGCGCAGGCTCGAGGCTTACCTGGCCACGTCTAACACGCCCGACCTCGACCTGACC
GGCCAGATGGATACGTCGCCCGTTCCACGGTCCCATGCTGGGCCGCGATATCGGTCACCCGCTCCGGGCACGAGC
GGCGCCGACACGCCGCGGGATCTCAACGCCCGGGTCAAGATACTGGAGCTGTACACGCTACACGTTCTGCTGCGC
AACAACGAGTGGGACTACGCCCGCGAATTTATCAGCGTCAGCTCCGTCCTCGACGACGAGCGGCGCGAGGCCTTT
CTCCAGGCCCTCGAGAGCCTGCAAGAGGAGCAGCAGGAACAAGAGCGGTTGGAACGGGCGGAGCGCCGCCGCCAA
GAGGAGCAGCTGCGCCGCCAAATCGACGACGCGAGACGCTTGCGCGCCGAAAACGAAGAATGGGAGCGGAGACGA
CTGGACGAGGCGCGTCGGACGCGGCGTCCCAGCACAGAGGTCGACTACGGCGTCCAAGGGAGTCCGACTCCCGAT
GCCCGCCTTGGCAGCAGGCCGCAGCAGCGGACGTCGCGCATACCCGCCTCCTCATCTGGCGGTAAGCCCGCGGTG
CCCAGGACGTTTACGGCGCGCGCGGGCATGATATTGTCCCGGCTACGGGCCGTCCTCGACGGGCTCGCCGCCTCG
CTCAACGGGAATCCGGCCTTGTTGGCGAGGCTGCTCGCCTTTGTCGTCGGCCTGTTGGTCCTGGTAGGACACGGC
GGCATCAGACATCGGATACAGCGCGTGCTGGGAGCGTCTTGGACCAAGTTCAAGGCTACGGCGGGCATGGGCACC
AAGATCAGCTACATATGA
Gene >Ophio5|3212
ATGACGTCCGTCGACGAAGGCTCCGCCACCGGCCCTTTCGCCGCCACCGATTCTTCGTTGGGCGAGACCTTTCGG
CGCAGCCTGCTCTCGTCCTCCCTCTCGGCCTACTCGGTCGGATCTTCGGCCGGCTCCTCGACGGCGGCCCGCCGT
TCGTCGCACATATCCAAGACGTACCGTCAGGCCTCAACGCTCTTCCTGACCCGTCGTCTGCCCGAGGCTCTGACG
ACGCTGACTCCCCTCATCGTCCCGGGCGACAACGGCGAGCCCGCGCCCGTGGCCAAGGCCTCACGCACGTCGCGC
ATCAAGGTCTGGAGCCTTTACCTGACCATCCTCCATGCCGTCGTGGAGATGAACCCCGACGACGGTAAGGAGGCC
TTTGGCAATCAGGATTGGAGGGCTCTATGCGCCAAGGTTCGAGACGGTCTCGTCTGGGAGGAGGTCGTGCGGGAC
GGCTACCACGGCGTCGAGGGAGATGTCGACTCTGACGTCGTCATCAATCTGTGAGTATTTGGCTCAGGCTTCTTG
TCGCCTTGTCATTTTTTTCCTCCTTTTGGCCGTGCTGATGGATGTTATGCCACCAGGGCGACGCTCCTCTTGGCG
CACGCGCGCGACCAGACCTTGAACCAGCGCAGGCTCGAGGCTTACCTGGCCACGTCTAACACGCCCGACCTCGAC
CTGACCGGCCAGATGGATACGTCGCCCGTTCCACGGTCCCATGCTGGGCCGCGATATCGGTCACCCGCTCCGGGC
ACGAGCGGCGCCGACACGCCGCGGGATCTCAACGCCCGGGTCAAGATACTGGAGCTGTACACGCTACACGTTCTG
CTGCGCAACAACGAGTGGGACTACGCCCGCGAATTTATCAGCGTCAGCTCCGTCCTCGACGACGAGCGGCGCGAG
GCCTTTCTCCAGGCCCTCGAGAGCCTGCAAGAGGAGCAGCAGGAACAAGAGCGGTTGGAACGGGCGGAGCGCCGC
CGCCAAGAGGAGCAGCTGCGCCGCCAAATCGACGACGCGAGACGCTTGCGCGCCGAAAACGAAGAATGGGAGCGG
AGACGACTGGACGAGGCGCGTCGGACGCGGCGTCCCAGCACAGAGGTCGACTACGGCGTCCAAGGGAGTCCGACT
CCCGATGCCCGCCTTGGCAGCAGGCCGCAGCAGCGGACGTCGCGCATACCCGCCTCCTCATCTGGCGGTAAGCCC
GCGGTGCCCAGGACGTTTACGGCGCGCGCGGGCATGATATTGTCCCGGCTACGGGCCGTCCTCGACGGGCTCGCC
GCCTCGCTCAACGGGAATCCGGCCTTGTTGGCGAGGCTGCTCGCCTTTGTCGTCGGCCTGTTGGTCCTGGTAGGA
CACGGCGGCATCAGACATCGGATACAGCGCGTGCTGGGAGCGTCTTGGACCAAGTTCAAGGCTACGGCGGGCATG
GGCACCAAGATCAGCTACATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail