Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3201
Gene name
Locationscaffold_253:16138..18311
Strand+
Gene length (bp)2173
Transcript length (bp)2043
Coding sequence length (bp)2040
Protein length (aa) 680

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 3.6E-41 156 474
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 3.7E-09 317 397

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ST62|NDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=1 SV=1 132 676 5.0E-103
sp|M1BYJ7|ENDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=3 SV=1 132 676 3.0E-102
sp|Q1JPL4|NDB1_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Arabidopsis thaliana GN=NDB1 PE=1 SV=1 157 676 4.0E-102
sp|Q94BV7|NDB2_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial OS=Arabidopsis thaliana GN=NDB2 PE=1 SV=1 154 680 1.0E-93
sp|F4JJJ3|NDB3_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial OS=Arabidopsis thaliana GN=NDB3 PE=2 SV=1 154 676 2.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ST62|NDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=1 SV=1 132 676 5.0E-103
sp|M1BYJ7|ENDB1_SOLTU External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Solanum tuberosum GN=NDB1 PE=3 SV=1 132 676 3.0E-102
sp|Q1JPL4|NDB1_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial OS=Arabidopsis thaliana GN=NDB1 PE=1 SV=1 157 676 4.0E-102
sp|Q94BV7|NDB2_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial OS=Arabidopsis thaliana GN=NDB2 PE=1 SV=1 154 680 1.0E-93
sp|F4JJJ3|NDB3_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial OS=Arabidopsis thaliana GN=NDB3 PE=2 SV=1 154 676 2.0E-92
sp|Q9SKT7|NDB4_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B4, mitochondrial OS=Arabidopsis thaliana GN=NDB4 PE=1 SV=1 154 680 3.0E-85
sp|F2Z699|NDH2_YARLI External alternative NADH-ubiquinone oxidoreductase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NDH2 PE=1 SV=1 138 678 4.0E-66
sp|Q55CD9|NDH_DICDI Probable NADH dehydrogenase OS=Dictyostelium discoideum GN=DDB_G0270104 PE=3 SV=2 156 478 7.0E-66
sp|Q07500|NDH2_YEAST External NADH-ubiquinone oxidoreductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE2 PE=1 SV=1 130 676 1.0E-65
sp|P40215|NDH1_YEAST External NADH-ubiquinone oxidoreductase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDE1 PE=1 SV=1 157 676 5.0E-64
sp|O43090|NDH2_SCHPO Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.15c PE=3 SV=1 142 474 5.0E-59
sp|O14121|NDH1_SCHPO Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.07 PE=3 SV=1 154 486 1.0E-51
sp|M0ZYF3|INDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=3 SV=1 146 497 1.0E-50
sp|Q9ST63|NDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=1 SV=1 146 497 2.0E-50
sp|P32340|NDI1_YEAST Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDI1 PE=1 SV=1 154 474 1.0E-48
sp|Q8GWA1|NDA1_ARATH Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Arabidopsis thaliana GN=NDA1 PE=2 SV=1 144 497 7.0E-48
sp|O80874|NDA2_ARATH Internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial OS=Arabidopsis thaliana GN=NDA2 PE=2 SV=1 153 497 2.0E-45
sp|O05267|YUMB_BACSU NADH dehydrogenase-like protein YumB OS=Bacillus subtilis (strain 168) GN=yumB PE=3 SV=1 150 567 8.0E-21
sp|Q4L4V6|Y2010_STAHJ NADH dehydrogenase-like protein SH2010 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH2010 PE=3 SV=1 150 532 2.0E-15
sp|P32340|NDI1_YEAST Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NDI1 PE=1 SV=1 558 677 4.0E-15
sp|Q49W80|Y1834_STAS1 NADH dehydrogenase-like protein SSP1834 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1834 PE=3 SV=1 150 532 2.0E-14
sp|Q5HQM1|Y527_STAEQ NADH dehydrogenase-like protein SERP0527 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0527 PE=3 SV=1 150 474 5.0E-14
sp|Q8CPV5|Y635_STAES NADH dehydrogenase-like protein SE_0635 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0635 PE=3 SV=1 150 474 5.0E-14
sp|Q8NXG0|Y823_STAAW NADH dehydrogenase-like protein MW0823 OS=Staphylococcus aureus (strain MW2) GN=MW0823 PE=3 SV=1 150 518 5.0E-14
sp|Q6GAY5|Y811_STAAS NADH dehydrogenase-like protein SAS0811 OS=Staphylococcus aureus (strain MSSA476) GN=SAS0811 PE=3 SV=1 150 518 5.0E-14
sp|Q7A6J4|Y802_STAAN NADH dehydrogenase-like protein SA0802 OS=Staphylococcus aureus (strain N315) GN=SA0802 PE=1 SV=1 150 518 6.0E-14
sp|Q2FID4|Y844_STAA3 NADH dehydrogenase-like protein SAUSA300_0844 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0844 PE=3 SV=1 150 518 6.0E-14
sp|Q2FZV7|Y878_STAA8 NADH dehydrogenase-like protein SAOUHSC_00878 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00878 PE=1 SV=1 150 518 6.0E-14
sp|Q6GIE7|Y903_STAAR NADH dehydrogenase-like protein SAR0903 OS=Staphylococcus aureus (strain MRSA252) GN=SAR0903 PE=3 SV=1 150 518 6.0E-14
sp|Q99VE0|Y941_STAAM NADH dehydrogenase-like protein SAV0941 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0941 PE=3 SV=1 150 518 6.0E-14
sp|Q5HHE4|Y944_STAAC NADH dehydrogenase-like protein SACOL0944 OS=Staphylococcus aureus (strain COL) GN=SACOL0944 PE=3 SV=1 150 518 6.0E-14
sp|Q2YWP9|Y807_STAAB NADH dehydrogenase-like protein SAB0807 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB0807 PE=3 SV=1 150 518 6.0E-14
sp|P44856|DHNA_HAEIN NADH dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ndh PE=3 SV=1 180 586 2.0E-12
sp|P00393|DHNA_ECOLI NADH dehydrogenase OS=Escherichia coli (strain K12) GN=ndh PE=1 SV=2 180 475 2.0E-12
sp|Q8GXR9|DHNA_ARATH Alternative NAD(P)H-ubiquinone oxidoreductase C1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=NDC1 PE=1 SV=2 140 479 2.0E-11
sp|O14121|NDH1_SCHPO Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.07 PE=3 SV=1 545 680 5.0E-11
sp|O32117|YUTJ_BACSU NADH dehydrogenase-like protein YutJ OS=Bacillus subtilis (strain 168) GN=yutJ PE=3 SV=2 156 476 3.0E-09
sp|Q8GWA1|NDA1_ARATH Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Arabidopsis thaliana GN=NDA1 PE=2 SV=1 562 680 3.0E-09
sp|Q9ST63|NDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=1 SV=1 564 680 3.0E-09
sp|M0ZYF3|INDA1_SOLTU Internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial OS=Solanum tuberosum GN=NDA1 PE=3 SV=1 564 680 4.0E-09
sp|O80874|NDA2_ARATH Internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial OS=Arabidopsis thaliana GN=NDA2 PE=2 SV=1 563 680 2.0E-08
sp|O43090|NDH2_SCHPO Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.15c PE=3 SV=1 552 675 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 36.41 19.88 52.95
CcL In ants, during behavior modification 2.41 0.32 4.50
CcD In ants, recently dead 2.29 0.50 4.08

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.922227 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3201
MLLPLGRQQAYTRLSRCGRSCLRLEPQLVSCIQNGLQQSTTPFKRLAKRRLIGLAPGCIRGISGKPLPQARSWIH
NFFYRAAAWVGTSIVVVGGCIVAFFVYDSTTYKEGADLGDIDVSQLALQPRRGGPKNLPIAEVFVDDDDSEAKKL
SKHKPRLVVLGGGWGGVALLKELDPDDYHVTVISPRNYFLFTPMLPSATVGTLELRSLVEPIRRIISRVHGHFIC
ARAEDVLFADRLIEVSQLDSGGKETRFYVPYDKLVIAVGSVTNPHGVKGLNNAFFLKDLDDSRQIRNRVIRNLEL
ACLPTTSDEERRRLLSFVICGGGPTGVEVAAELFDLLNEDLTRMFPRLLRNEISVHLIQSRSHILNTYDETVSHY
AEKRFARDQVEVLTNSRVKEVLPDKIIFTQKQADGGLVTKELPAGFCLWSTGLSPTALSQKLAQRLGDFQTNRHA
LETDTHLRVNGTPLGDVYAVGDCSTVQNNVTDHVISFLRSYAWKRGKDPETIQLSFNDWQQVAREVKKRFPQAVN
HLRRLDKLFAEFDKDESGTLDLGELRELLSQIDNKLTSLPATAQRAHQQGSYLAYKLHKLARLSDGLSVNDVRDG
DVDAAAYKAFEYRHLGNLAYLGNAAVFDLGRGGWSVAGGLWAVYAWRSVYFAQSVSFRTRSLMAMDWAKRALFGR
DFASL
Coding >Ophio5|3201
ATGCTCCTCCCTCTCGGCCGTCAGCAAGCCTACACACGACTCTCGCGATGCGGGCGCTCGTGCCTCCGCCTGGAG
CCGCAGCTCGTATCATGTATACAAAACGGCCTCCAGCAGTCGACGACCCCCTTCAAAAGACTGGCAAAGAGACGG
CTCATCGGACTAGCCCCGGGCTGCATCCGCGGCATATCTGGAAAGCCTCTCCCCCAGGCCAGATCTTGGATCCAC
AACTTCTTCTATCGGGCCGCTGCGTGGGTGGGCACTTCGATCGTCGTCGTCGGTGGCTGCATCGTCGCCTTCTTC
GTCTATGATTCAACCACGTACAAGGAGGGCGCTGATCTCGGCGACATCGACGTCTCCCAACTGGCGCTGCAGCCT
CGTCGCGGAGGCCCCAAGAACTTGCCCATCGCAGAAGTCTTTGTCGACGATGACGACAGCGAGGCCAAGAAGCTC
TCCAAGCATAAGCCCAGGCTGGTCGTCTTGGGCGGCGGCTGGGGCGGCGTCGCGCTTCTCAAGGAGTTGGATCCG
GACGATTACCATGTGACTGTGATATCGCCGAGAAACTACTTTCTCTTCACTCCCATGCTGCCTTCGGCCACGGTC
GGCACCCTAGAGTTGCGGTCTCTCGTTGAGCCGATTCGTCGCATCATCAGCCGGGTTCATGGCCATTTTATCTGC
GCCAGGGCCGAGGACGTCCTCTTCGCGGACAGGTTGATTGAGGTCTCGCAGCTGGATTCCGGCGGTAAGGAGACT
CGCTTCTACGTGCCGTACGACAAGCTCGTCATCGCTGTTGGGTCCGTTACCAACCCGCATGGTGTCAAGGGGCTC
AACAATGCCTTCTTCCTCAAGGACCTGGATGACTCGCGCCAGATTCGTAACAGAGTGATTCGCAACCTGGAGCTT
GCTTGCCTGCCGACCACGTCGGATGAGGAGCGCAGACGGCTGCTGTCCTTTGTCATCTGCGGCGGTGGCCCTACC
GGTGTTGAGGTTGCCGCTGAGCTGTTCGATCTTCTGAACGAGGACCTGACGCGAATGTTTCCTCGGCTTTTGAGA
AACGAGATCTCGGTCCATCTGATCCAGAGTCGAAGTCATATCCTCAACACGTATGACGAGACCGTCTCCCACTAC
GCCGAGAAGCGATTCGCCCGCGACCAGGTCGAGGTGCTCACCAACTCGAGAGTCAAAGAGGTGCTGCCGGACAAG
ATCATCTTCACCCAAAAGCAGGCAGACGGCGGCTTGGTGACAAAGGAGCTGCCAGCCGGCTTCTGCCTCTGGTCA
ACAGGCCTGTCTCCAACGGCGCTCAGCCAGAAGCTGGCCCAGCGGCTGGGCGACTTTCAGACGAACCGCCACGCG
CTCGAGACAGACACGCACCTACGGGTCAACGGAACGCCGCTGGGCGATGTCTACGCCGTCGGCGACTGCTCGACG
GTGCAGAACAACGTAACCGACCACGTCATCAGCTTCCTCCGTTCCTACGCCTGGAAGCGTGGCAAGGACCCGGAG
ACGATCCAGCTGAGCTTCAACGACTGGCAGCAGGTAGCGCGAGAAGTGAAGAAGCGCTTCCCCCAAGCCGTCAAC
CACCTCCGAAGGCTCGACAAGCTCTTCGCCGAGTTTGACAAGGACGAGTCCGGGACGCTGGACCTCGGCGAGCTT
CGAGAGCTCCTCAGCCAGATCGACAACAAGCTGACCTCCCTCCCGGCCACCGCCCAGCGCGCCCACCAGCAGGGC
TCCTACCTGGCCTACAAGCTGCACAAGCTGGCCCGGCTGTCCGACGGGCTGAGCGTCAACGACGTGCGCGACGGC
GACGTCGACGCCGCCGCCTACAAGGCCTTTGAGTATCGCCACCTCGGCAACCTGGCCTATCTCGGCAACGCCGCC
GTCTTCGACCTCGGACGGGGCGGCTGGAGCGTCGCGGGTGGCCTGTGGGCTGTTTATGCCTGGCGTTCCGTCTAT
TTTGCCCAGAGTGTGAGCTTTCGGACTCGCTCGCTCATGGCTATGGATTGGGCGAAGAGGGCCTTGTTTGGACGA
GACTTTGCAAGCCTC
Transcript >Ophio5|3201
ATGCTCCTCCCTCTCGGCCGTCAGCAAGCCTACACACGACTCTCGCGATGCGGGCGCTCGTGCCTCCGCCTGGAG
CCGCAGCTCGTATCATGTATACAAAACGGCCTCCAGCAGTCGACGACCCCCTTCAAAAGACTGGCAAAGAGACGG
CTCATCGGACTAGCCCCGGGCTGCATCCGCGGCATATCTGGAAAGCCTCTCCCCCAGGCCAGATCTTGGATCCAC
AACTTCTTCTATCGGGCCGCTGCGTGGGTGGGCACTTCGATCGTCGTCGTCGGTGGCTGCATCGTCGCCTTCTTC
GTCTATGATTCAACCACGTACAAGGAGGGCGCTGATCTCGGCGACATCGACGTCTCCCAACTGGCGCTGCAGCCT
CGTCGCGGAGGCCCCAAGAACTTGCCCATCGCAGAAGTCTTTGTCGACGATGACGACAGCGAGGCCAAGAAGCTC
TCCAAGCATAAGCCCAGGCTGGTCGTCTTGGGCGGCGGCTGGGGCGGCGTCGCGCTTCTCAAGGAGTTGGATCCG
GACGATTACCATGTGACTGTGATATCGCCGAGAAACTACTTTCTCTTCACTCCCATGCTGCCTTCGGCCACGGTC
GGCACCCTAGAGTTGCGGTCTCTCGTTGAGCCGATTCGTCGCATCATCAGCCGGGTTCATGGCCATTTTATCTGC
GCCAGGGCCGAGGACGTCCTCTTCGCGGACAGGTTGATTGAGGTCTCGCAGCTGGATTCCGGCGGTAAGGAGACT
CGCTTCTACGTGCCGTACGACAAGCTCGTCATCGCTGTTGGGTCCGTTACCAACCCGCATGGTGTCAAGGGGCTC
AACAATGCCTTCTTCCTCAAGGACCTGGATGACTCGCGCCAGATTCGTAACAGAGTGATTCGCAACCTGGAGCTT
GCTTGCCTGCCGACCACGTCGGATGAGGAGCGCAGACGGCTGCTGTCCTTTGTCATCTGCGGCGGTGGCCCTACC
GGTGTTGAGGTTGCCGCTGAGCTGTTCGATCTTCTGAACGAGGACCTGACGCGAATGTTTCCTCGGCTTTTGAGA
AACGAGATCTCGGTCCATCTGATCCAGAGTCGAAGTCATATCCTCAACACGTATGACGAGACCGTCTCCCACTAC
GCCGAGAAGCGATTCGCCCGCGACCAGGTCGAGGTGCTCACCAACTCGAGAGTCAAAGAGGTGCTGCCGGACAAG
ATCATCTTCACCCAAAAGCAGGCAGACGGCGGCTTGGTGACAAAGGAGCTGCCAGCCGGCTTCTGCCTCTGGTCA
ACAGGCCTGTCTCCAACGGCGCTCAGCCAGAAGCTGGCCCAGCGGCTGGGCGACTTTCAGACGAACCGCCACGCG
CTCGAGACAGACACGCACCTACGGGTCAACGGAACGCCGCTGGGCGATGTCTACGCCGTCGGCGACTGCTCGACG
GTGCAGAACAACGTAACCGACCACGTCATCAGCTTCCTCCGTTCCTACGCCTGGAAGCGTGGCAAGGACCCGGAG
ACGATCCAGCTGAGCTTCAACGACTGGCAGCAGGTAGCGCGAGAAGTGAAGAAGCGCTTCCCCCAAGCCGTCAAC
CACCTCCGAAGGCTCGACAAGCTCTTCGCCGAGTTTGACAAGGACGAGTCCGGGACGCTGGACCTCGGCGAGCTT
CGAGAGCTCCTCAGCCAGATCGACAACAAGCTGACCTCCCTCCCGGCCACCGCCCAGCGCGCCCACCAGCAGGGC
TCCTACCTGGCCTACAAGCTGCACAAGCTGGCCCGGCTGTCCGACGGGCTGAGCGTCAACGACGTGCGCGACGGC
GACGTCGACGCCGCCGCCTACAAGGCCTTTGAGTATCGCCACCTCGGCAACCTGGCCTATCTCGGCAACGCCGCC
GTCTTCGACCTCGGACGGGGCGGCTGGAGCGTCGCGGGTGGCCTGTGGGCTGTTTATGCCTGGCGTTCCGTCTAT
TTTGCCCAGAGTGTGAGCTTTCGGACTCGCTCGCTCATGGCTATGGATTGGGCGAAGAGGGCCTTGTTTGGACGA
GACTTTGCAAGCCTCTAA
Gene >Ophio5|3201
ATGCTCCTCCCTCTCGGCCGTCAGCAAGCCTACACACGACTCTCGCGATGCGGGCGCTCGTGCCTCCGCCTGGAG
CCGCAGCTCGTATCATGGTTGGCGGTTCGCGGCGTCCTGTCTTGAATCTTCTGCTGAGGGTGCAGCCTAGTATAC
AAAACGGCCTCCAGCAGTCGACGACCCCCTTCAAAAGACTGGCAAAGAGACGGCTCATCGGACTAGCCCCGGGCT
GCATCCGCGGCATATCTGGAAAGCCTCTCCCCCAGGCCAGATCTTGGATCCACAACTTCTTCTATCGGGCCGCTG
CGTGGGTGGGCACTTCGATCGTCGTCGTCGGTGGCTGCATCGTCGCCTTCTTCGTCTATGATTCAACCACGTACA
AGGAGGGCGCTGATCTCGGCGACATCGACGTCTCCCAACTGGCGCTGCAGCCTCGTCGCGGAGGCCCCAAGAACT
TGCCCATCGCAGAAGTCTTTGTCGACGATGACGACAGCGAGGCCAAGAAGCTCTCCAAGCATAAGCCCAGGCTGG
TCGTCTTGGGCGGCGGCTGGGGCGGCGTCGCGCTTCTCAAGGAGTTGGATCCGGACGATTACCATGTGACTGTGA
TATCGCCGAGAAACTACTTTCTCTTCACTCCCATGCTGCCTTCGGCCACGGTCGGCACCCTAGAGTTGCGGTCTC
TCGTTGAGCCGATTCGTCGCATCATCAGCCGGGTTCATGGCCATTTTATCTGCGCCAGGGCCGAGGACGTCCTCT
TCGCGGACAGGTTGATTGAGGTCTCGCAGCTGGATTCCGGCGGTAAGGAGACTCGCTTCTACGTGCCGTACGACA
AGCTCGTCATCGCTGTTGGGTCCGTTACCAACCCGCATGGTGTCAAGGGGCTCAACAATGCCTTCTTCCTCAAGG
ACCTGGATGACTCGCGCCAGATTCGTAACAGAGTGATTCGCAACCTGGAGCTTGCTTGCCTGCCGACCACGTCGG
ATGAGGAGCGCAGACGGCTGCTGTCCTTTGTCATCTGCGGCGGTGGCCCTACCGGTGTTGAGGTTGCCGCTGAGC
TGTTCGATCTTCTGAACGAGGACCTGACGCGAATGTTTCCTCGGCTTTTGAGAAACGAGATCTCGGTCCATCTGA
TCCAGAGTCGAAGTCATATCCTCAACACGTATGACGAGACCGTCTCCCACTACGCCGAGAAGCGATTCGCCCGCG
ACCAGGTCGAGGTGCTCACCAACTCGAGAGTCAAAGAGGTGCTGCCGGACAAGATCATCTTCACCCAAAAGCAGG
CAGACGGCGGCTTGGTGACAAAGGAGCTGCCAGCCGGCTTCTGCCTCTGGTCAACAGGCCTGTCTCCAACGGCGC
TCAGCCAGAAGCTGGCCCAGCGGCTGGGCGACTTTCAGACGAACCGCCACGCGCTCGAGACAGACACGCACCTAC
GGGTCAACGGAACGCCGCTGGGCGATGTCTACGCCGTCGGCGACTGCTCGACGGTGCAGAACAACGTAACCGACC
ACGTCATCAGCTTCCTCCGTTCCTACGCCTGGAAGCGTGGCAAGGACCCGGAGACGATCCAGCTGAGCTTCAACG
ACTGGCAGCAGGTAGCGCGAGAAGTGAAGAAGCGCTTCCCCCAAGCCGTCAACCACCTCCGAAGGCTCGACAAGC
TCTTCGCCGAGTTTGACAAGGACGAGTCCGGGACGCTGGACCTCGGCGAGCTTCGAGAGCTCCTCAGCCAGATCG
ACAACAAGCTGACCTCCCTCCCGGCCACCGCCCAGCGCGCCCACCAGCAGGGCTCCTACCTGGCCTACAAGCTGC
ACAAGCTGGCCCGGCTGTCCGACGGGCTGAGCGTCAACGACGTGCGCGACGGCGACGTCGACGCCGCCGCCTACA
AGGCCTTTGAGTATCGCCACCTCGGCAACCTGGCCTATCTCGGCAACGCCGCCGTCTTCGACCTCGGACGGGGCG
GCTGGAGCGTCGCGGGTGGCCTGTGGGCTGTTTATGCCTGGCGTTCCGTCTATTTTGCCCAGAGTGTGAGCTTTC
GGACTCGCTCGCTCATGGCTATGGATTGGGCGAAGAGGGCCTTGTTTGGACGAGGTTCGTCACATTCAATCCCCC
CCCCCCCCTTTTTTTTTGTGGTCATGTTTGATGTGTGGCGCTGACACTCGTCCTAGACTTTGCAAGCCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail