Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3198
Gene name
Locationscaffold_253:10697..11405
Strand+
Gene length (bp)708
Transcript length (bp)600
Coding sequence length (bp)597
Protein length (aa) 199

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04800 NDUS4 NADH dehydrogenase ubiquinone Fe-S protein 4 4.1E-34 95 191

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25711|NDUS4_NEUCR NADH-ubiquinone oxidoreductase 21 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-21 PE=1 SV=2 1 199 7.0E-87
sp|P0CB96|NDUS4_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Pongo pygmaeus GN=NDUFS4 PE=2 SV=1 60 191 4.0E-18
sp|P0CB95|NDUS4_PONAB NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Pongo abelii GN=NDUFS4 PE=2 SV=1 60 191 4.0E-18
sp|O43181|NDUS4_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens GN=NDUFS4 PE=1 SV=1 60 191 6.0E-18
sp|Q0MQH0|NDUS4_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS4 PE=2 SV=1 60 191 6.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25711|NDUS4_NEUCR NADH-ubiquinone oxidoreductase 21 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo-21 PE=1 SV=2 1 199 7.0E-87
sp|P0CB96|NDUS4_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Pongo pygmaeus GN=NDUFS4 PE=2 SV=1 60 191 4.0E-18
sp|P0CB95|NDUS4_PONAB NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Pongo abelii GN=NDUFS4 PE=2 SV=1 60 191 4.0E-18
sp|O43181|NDUS4_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens GN=NDUFS4 PE=1 SV=1 60 191 6.0E-18
sp|Q0MQH0|NDUS4_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS4 PE=2 SV=1 60 191 6.0E-18
sp|Q66XS7|NDUS4_GECJA NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Gecko japonicus GN=NDUFS4 PE=2 SV=1 59 191 2.0E-17
sp|Q02375|NDUS4_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Bos taurus GN=NDUFS4 PE=1 SV=1 76 191 2.0E-17
sp|Q0MQH1|NDUS4_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Pan troglodytes GN=NDUFS4 PE=2 SV=1 60 191 7.0E-17
sp|Q9CXZ1|NDUS4_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Mus musculus GN=Ndufs4 PE=1 SV=3 76 191 8.0E-17
sp|Q5XIF3|NDUS4_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Rattus norvegicus GN=Ndufs4 PE=1 SV=1 76 191 9.0E-16
sp|Q9FJW4|NDUS4_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Arabidopsis thaliana GN=FRO1 PE=2 SV=1 84 186 3.0E-14
sp|Q8T1V6|NDUS4_DICDI NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Dictyostelium discoideum GN=ndufs4 PE=3 SV=2 64 188 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0022900 electron transport chain Yes
GO:0005747 mitochondrial respiratory chain complex I Yes
GO:0098803 respiratory chain complex No
GO:0008150 biological_process No
GO:0098798 mitochondrial protein-containing complex No
GO:0032991 protein-containing complex No
GO:1902494 catalytic complex No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:1990204 oxidoreductase complex No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0045271 respiratory chain complex I No
GO:0030964 NADH dehydrogenase complex No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0006091 generation of precursor metabolites and energy No
GO:1902495 transmembrane transporter complex No
GO:1990351 transporter complex No
GO:0098796 membrane protein complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 143.74 78.25 209.22
CcL In ants, during behavior modification 185.39 101.05 269.72
CcD In ants, recently dead 226.44 122.77 330.12

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.283371 no
SC16a CcD 0.042846 yes
CcL CcD 0.417605 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3198
MASIRSHSARRLWQTASASRTPRLCASRRFQSDVATRPDALPTVPTPNEPDYNIPPDKATSTFTPVPKQIQEGSE
DISLPAAVISGAPMELQARTVRIYKESKPATQSGDFRGRHWRMDWDILPKGHRWENELMGWQSSGDFMQGTHLNF
ETKEDAIQFADKQGYEYFVQEPSSRKFTPKAYANNFLYSPKKLKHIRTK
Coding >Ophio5|3198
ATGGCCTCAATCAGGAGCCATAGTGCCAGACGGCTATGGCAGACTGCCTCGGCCTCACGTACGCCTCGCCTCTGT
GCCTCTCGACGCTTCCAGAGCGACGTAGCAACTCGCCCGGATGCCCTCCCGACCGTTCCAACCCCGAATGAGCCA
GACTATAACATACCTCCCGACAAGGCCACCTCCACTTTCACTCCCGTACCGAAGCAGATCCAAGAGGGCAGCGAA
GATATATCTCTGCCCGCAGCCGTCATCTCCGGTGCCCCGATGGAACTCCAGGCTCGGACGGTCCGCATCTACAAG
GAGTCCAAACCCGCGACTCAATCTGGCGACTTCAGAGGACGCCACTGGCGGATGGATTGGGATATCCTTCCCAAA
GGTCACCGGTGGGAGAACGAGCTGATGGGTTGGCAGTCGTCGGGGGACTTTATGCAGGGCACCCATTTAAACTTC
GAAACCAAAGAGGACGCCATTCAGTTCGCCGACAAGCAGGGTTACGAGTATTTCGTCCAGGAACCCAGTTCACGC
AAATTCACGCCCAAGGCTTACGCCAACAACTTCCTCTACTCCCCCAAGAAGCTCAAGCATATTCGGACGAAA
Transcript >Ophio5|3198
ATGGCCTCAATCAGGAGCCATAGTGCCAGACGGCTATGGCAGACTGCCTCGGCCTCACGTACGCCTCGCCTCTGT
GCCTCTCGACGCTTCCAGAGCGACGTAGCAACTCGCCCGGATGCCCTCCCGACCGTTCCAACCCCGAATGAGCCA
GACTATAACATACCTCCCGACAAGGCCACCTCCACTTTCACTCCCGTACCGAAGCAGATCCAAGAGGGCAGCGAA
GATATATCTCTGCCCGCAGCCGTCATCTCCGGTGCCCCGATGGAACTCCAGGCTCGGACGGTCCGCATCTACAAG
GAGTCCAAACCCGCGACTCAATCTGGCGACTTCAGAGGACGCCACTGGCGGATGGATTGGGATATCCTTCCCAAA
GGTCACCGGTGGGAGAACGAGCTGATGGGTTGGCAGTCGTCGGGGGACTTTATGCAGGGCACCCATTTAAACTTC
GAAACCAAAGAGGACGCCATTCAGTTCGCCGACAAGCAGGGTTACGAGTATTTCGTCCAGGAACCCAGTTCACGC
AAATTCACGCCCAAGGCTTACGCCAACAACTTCCTCTACTCCCCCAAGAAGCTCAAGCATATTCGGACGAAATGA
Gene >Ophio5|3198
ATGGCCTCAATCAGGAGCCATAGTGCCAGACGGCTATGGCAGACTGCCTCGGCCTCACGTACGCCTCGCCTCTGT
GCCTCTCGACGCTTCCAGAGCGACGTAGCAACTCGCCCGGATGCCCTCCCGACCGTTCCAACCCCGAATGAGCCA
GACTATAACATACCTCCCGACAAGGCCACCTCGTGCGCTCATCGCCATCACCGAGACTCGTACAGGAGCTGACAG
CGGTGCCCAGCACTTTCACTCCCGTACCGAAGCAGATCCAAGAGGGCAGCGAAGATATATCTCTGCCCGCAGCCG
TCATCTCCGGTGCCCCGATGGAACTCCAGGCTCGGACGGTCCGGTTAGTTTCGCCTCTGTCGCCACATTTTGATG
CGCAGCGTCTGACGTACCCACAGCATCTACAAGGAGTCCAAACCCGCGACTCAATCTGGCGACTTCAGAGGACGC
CACTGGCGGATGGATTGGGATATCCTTCCCAAAGGTCACCGGTGGGAGAACGAGCTGATGGGTTGGCAGTCGTCG
GGGGACTTTATGCAGGGCACCCATTTAAACTTCGAAACCAAAGAGGACGCCATTCAGTTCGCCGACAAGCAGGGT
TACGAGTATTTCGTCCAGGAACCCAGTTCACGCAAATTCACGCCCAAGGCTTACGCCAACAACTTCCTCTACTCC
CCCAAGAAGCTCAAGCATATTCGGACGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail