Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3197
Gene name
Locationscaffold_253:9779..10436
Strand-
Gene length (bp)657
Transcript length (bp)306
Coding sequence length (bp)303
Protein length (aa) 101

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10791 F1F0-ATPsyn_F Mitochondrial F1-F0 ATP synthase subunit F of fungi 3.5E-40 4 94

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06405|ATPK_YEAST ATP synthase subunit f, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP17 PE=1 SV=1 4 97 2.0E-28
sp|O94377|ATPK_SCHPO ATP synthase subunit f, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp17 PE=3 SV=1 9 99 1.0E-23

GO

GO Term Description Terminal node
GO:0015986 proton motive force-driven ATP synthesis Yes
GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) Yes
GO:0009165 nucleotide biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0009145 purine nucleoside triphosphate biosynthetic process No
GO:0009206 purine ribonucleoside triphosphate biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0006754 ATP biosynthetic process No
GO:0009201 ribonucleoside triphosphate biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0009142 nucleoside triphosphate biosynthetic process No
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o) No
GO:1901576 organic substance biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044238 primary metabolic process No
GO:0046034 ATP metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0032991 protein-containing complex No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0098798 mitochondrial protein-containing complex No
GO:1901564 organonitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0009117 nucleotide metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0098796 membrane protein complex No
GO:0006753 nucleoside phosphate metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain No
GO:1901135 carbohydrate derivative metabolic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0006163 purine nucleotide metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0098800 inner mitochondrial membrane protein complex No
GO:1901360 organic cyclic compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0009259 ribonucleotide metabolic process No
GO:0005575 cellular_component No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 72 91 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3197
MSFVTRRALSTLIPPKVASPKAIGGAPDALRMQRVVSFYEKLPRGPAPEIKGKGLLGWYQAKYFGEKTSVKPIIH
IIAFLVGIGYAQNYYFHLRHHKNNPH
Coding >Ophio5|3197
ATGAGCTTCGTCACCCGTCGAGCGCTTTCGACGCTCATCCCCCCGAAGGTCGCTTCGCCCAAGGCTATCGGCGGC
GCTCCCGATGCGTTGCGGATGCAACGCGTCGTCAGCTTCTACGAGAAGCTTCCTCGGGGTCCGGCTCCGGAGATC
AAGGGAAAAGGACTGCTCGGCTGGTACCAGGCCAAATACTTTGGCGAGAAGACCTCCGTTAAGCCTATAATTCAT
ATTATTGCTTTCCTGGTGGGCATCGGCTATGCGCAAAACTACTACTTCCATTTGCGCCATCACAAGAACAACCCC
CAC
Transcript >Ophio5|3197
ATGAGCTTCGTCACCCGTCGAGCGCTTTCGACGCTCATCCCCCCGAAGGTCGCTTCGCCCAAGGCTATCGGCGGC
GCTCCCGATGCGTTGCGGATGCAACGCGTCGTCAGCTTCTACGAGAAGCTTCCTCGGGGTCCGGCTCCGGAGATC
AAGGGAAAAGGACTGCTCGGCTGGTACCAGGCCAAATACTTTGGCGAGAAGACCTCCGTTAAGCCTATAATTCAT
ATTATTGCTTTCCTGGTGGGCATCGGCTATGCGCAAAACTACTACTTCCATTTGCGCCATCACAAGAACAACCCC
CACTAG
Gene >Ophio5|3197
ATGAGCTTCGTCACCCGTCGAGCGCTTTCGACGCTCATCCCCCCGAAGGTAAGGACACCGAACAGCAGCTCCATT
GCCAACTATTGACGCTTCTTGCAGGTCGCTTCGCCCAAGGTACATCTTCCTCCCTCGAATTGCGTCGATGTGTGT
GGCAAGTCGGTTATGCCGTGCGATGGAGAGAAACTTCGAGTGGCCAGGCGCTGTACCTTTGGTCGGCGACAGACT
TTGACCAGCTCGTGAATGGACTCCCGACCGGACGCCGAGCCTACGGGCTAACCCGTGATACTCGCAGGCTATCGG
CGGCGCTCCCGATGCGTTGCGGATGCAACGCGTCGTCAGCTTCTACGAGAAGCTTCCTCGGGGTCCGGCTCCGGA
GATCAAGGGAAAAGGACTGCTCGGCTGGTACCAGGCCAAATACTTTGGCGAGAAGACCTCCGTTAAGCGTATGCC
ACACAATGACGGCGACGTGAGATACTGTTTCGCTGACGGCAGCTCGGGCAGCTATAATTCATATTATTGCTTTCC
TGGTGGGCATCGGCTATGCGCAAAACTACTACTTCCATTTGCGTACGTTGCCCCGTCGATGACATTCCATGCTTC
GTCCCGGAAGCTAACGGTTATGTTTGCGAAGGCCATCACAAGAACAACCCCCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail