Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3193
Gene name
Locationscaffold_252:16703..24316
Strand+
Gene length (bp)7613
Transcript length (bp)6111
Coding sequence length (bp)6108
Protein length (aa) 2036

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00224 PK Pyruvate kinase, barrel domain 6.1E-170 1541 1886
PF00005 ABC_tran ABC transporter 5.8E-18 658 794
PF00005 ABC_tran ABC transporter 3.0E-24 1264 1417
PF02887 PK_C Pyruvate kinase, alpha/beta domain 1.6E-34 1902 2024
PF00664 ABC_membrane ABC transporter transmembrane region 6.6E-29 938 1182

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31865|KPYK_HYPJE Pyruvate kinase OS=Hypocrea jecorina GN=pki1 PE=3 SV=1 1500 2035 0.0E+00
sp|Q7RVA8|KPYK_NEUCR Pyruvate kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ace-8 PE=3 SV=1 1510 2036 0.0E+00
sp|Q12669|KPYK_ASPNG Pyruvate kinase OS=Aspergillus niger GN=pkiA PE=3 SV=1 1511 2035 0.0E+00
sp|P22360|KPYK_EMENI Pyruvate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pkiA PE=3 SV=2 1511 2035 0.0E+00
sp|P46614|KPYK_CANAL Pyruvate kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC19 PE=1 SV=3 1524 2026 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31865|KPYK_HYPJE Pyruvate kinase OS=Hypocrea jecorina GN=pki1 PE=3 SV=1 1500 2035 0.0E+00
sp|Q7RVA8|KPYK_NEUCR Pyruvate kinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ace-8 PE=3 SV=1 1510 2036 0.0E+00
sp|Q12669|KPYK_ASPNG Pyruvate kinase OS=Aspergillus niger GN=pkiA PE=3 SV=1 1511 2035 0.0E+00
sp|P22360|KPYK_EMENI Pyruvate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pkiA PE=3 SV=2 1511 2035 0.0E+00
sp|P46614|KPYK_CANAL Pyruvate kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC19 PE=1 SV=3 1524 2026 0.0E+00
sp|P30614|KPYK_YARLI Pyruvate kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PYK1 PE=3 SV=3 1524 2026 0.0E+00
sp|Q6BS75|KPYK_DEBHA Pyruvate kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PYK1 PE=3 SV=1 1524 2026 0.0E+00
sp|Q875M9|KPYK_KLULA Pyruvate kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PYK1 PE=3 SV=1 1523 2024 0.0E+00
sp|Q875S4|KPYK_LACK1 Pyruvate kinase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=PYK1 PE=3 SV=1 1523 2024 0.0E+00
sp|Q759A9|KPYK_ASHGO Pyruvate kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PYK1 PE=3 SV=1 1523 2024 0.0E+00
sp|Q6FV12|KPYK2_CANGA Pyruvate kinase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PYK2 PE=3 SV=1 1523 2023 0.0E+00
sp|Q6FIS9|KPYK1_CANGA Pyruvate kinase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PYK1 PE=3 SV=1 1523 2026 0.0E+00
sp|Q10208|KPYK_SCHPO Pyruvate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyk1 PE=1 SV=1 1526 2027 0.0E+00
sp|P00549|KPYK1_YEAST Pyruvate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC19 PE=1 SV=2 1523 2023 0.0E+00
sp|Q875Z9|KPYK_NAUCC Pyruvate kinase OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=PYK1 PE=3 SV=1 1539 2026 0.0E+00
sp|P52489|KPYK2_YEAST Pyruvate kinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYK2 PE=1 SV=1 1523 2023 0.0E+00
sp|O94122|KPYK_AGABI Pyruvate kinase OS=Agaricus bisporus GN=pkiA PE=2 SV=1 1523 2036 0.0E+00
sp|Q92122|KPYM_XENLA Pyruvate kinase PKM OS=Xenopus laevis GN=pkm PE=2 SV=1 1541 2024 4.0E-162
sp|P14618|KPYM_HUMAN Pyruvate kinase PKM OS=Homo sapiens GN=PKM PE=1 SV=4 1536 2024 5.0E-160
sp|P11980|KPYM_RAT Pyruvate kinase PKM OS=Rattus norvegicus GN=Pkm PE=1 SV=3 1541 2024 1.0E-158
sp|P11974|KPYM_RABIT Pyruvate kinase PKM OS=Oryctolagus cuniculus GN=PKM PE=1 SV=4 1541 2024 3.0E-158
sp|P00548|KPYM_CHICK Pyruvate kinase PKM OS=Gallus gallus GN=PKM PE=2 SV=2 1541 2024 8.0E-158
sp|Q5NVN0|KPYM_PONAB Pyruvate kinase PKM OS=Pongo abelii GN=PKM PE=2 SV=3 1536 2024 2.0E-157
sp|P11979|KPYM_FELCA Pyruvate kinase PKM OS=Felis catus GN=PKM PE=1 SV=2 1536 2024 5.0E-156
sp|P52480|KPYM_MOUSE Pyruvate kinase PKM OS=Mus musculus GN=Pkm PE=1 SV=4 1541 2024 9.0E-156
sp|O62619|KPYK_DROME Pyruvate kinase OS=Drosophila melanogaster GN=PyK PE=2 SV=2 1536 2027 2.0E-152
sp|Q29536|KPYR_CANLF Pyruvate kinase PKLR OS=Canis lupus familiaris GN=PKLR PE=2 SV=2 1541 2024 4.0E-151
sp|P12928|KPYR_RAT Pyruvate kinase PKLR OS=Rattus norvegicus GN=Pklr PE=1 SV=2 1541 2024 4.0E-148
sp|Q27686|KPYK_LEIME Pyruvate kinase OS=Leishmania mexicana GN=PYK PE=1 SV=2 1534 2024 1.0E-147
sp|P30613|KPYR_HUMAN Pyruvate kinase PKLR OS=Homo sapiens GN=PKLR PE=1 SV=2 1541 2024 1.0E-147
sp|P53657|KPYR_MOUSE Pyruvate kinase PKLR OS=Mus musculus GN=Pklr PE=1 SV=1 1541 2024 7.0E-147
sp|P30615|KPYK1_TRYBB Pyruvate kinase 1 OS=Trypanosoma brucei brucei GN=PYK1 PE=1 SV=1 1534 2024 1.0E-143
sp|P30616|KPYK2_TRYBB Pyruvate kinase 2 OS=Trypanosoma brucei brucei GN=PYK2 PE=3 SV=1 1534 2024 3.0E-143
sp|Q27788|KPYK_TRYBO Pyruvate kinase OS=Trypanoplasma borreli GN=PYK PE=3 SV=1 1534 2024 2.0E-133
sp|Q54RF5|KPYK_DICDI Pyruvate kinase OS=Dictyostelium discoideum GN=pyk PE=1 SV=1 1525 2024 5.0E-126
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 40 1466 4.0E-125
sp|O44006|KPYK_EIMTE Pyruvate kinase OS=Eimeria tenella GN=PYK PE=2 SV=1 1541 2024 1.0E-123
sp|Q42806|KPYC_SOYBN Pyruvate kinase, cytosolic isozyme OS=Glycine max PE=2 SV=1 1542 1965 1.0E-120
sp|O65595|KPYC_ARATH Probable pyruvate kinase, cytosolic isozyme OS=Arabidopsis thaliana GN=At4g26390 PE=3 SV=1 1542 2008 2.0E-118
sp|Q42954|KPYC_TOBAC Pyruvate kinase, cytosolic isozyme OS=Nicotiana tabacum PE=2 SV=1 1542 2024 3.0E-115
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 197 1466 4.0E-115
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 367 1466 5.0E-114
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 55 1477 8.0E-114
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 222 1466 1.0E-113
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 367 1466 3.0E-113
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 367 1466 6.0E-113
sp|P22200|KPYC_SOLTU Pyruvate kinase, cytosolic isozyme OS=Solanum tuberosum PE=2 SV=1 1542 1965 1.0E-112
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 367 1466 1.0E-112
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 102 1466 1.0E-112
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 195 1466 3.0E-112
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 55 1477 3.0E-112
sp|P80885|KPYK_BACSU Pyruvate kinase OS=Bacillus subtilis (strain 168) GN=pyk PE=1 SV=2 1541 2023 1.0E-111
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 222 1466 2.0E-111
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 55 1477 2.0E-110
sp|P51181|KPYK_BACLI Pyruvate kinase OS=Bacillus licheniformis GN=pyk PE=3 SV=1 1541 2023 2.0E-110
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 55 1477 3.0E-110
sp|Q02499|KPYK_GEOSE Pyruvate kinase OS=Geobacillus stearothermophilus GN=pyk PE=1 SV=2 1541 2023 1.0E-109
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 220 1466 1.0E-109
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 225 1466 5.0E-109
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 55 1477 2.0E-108
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 55 1466 1.0E-107
sp|Q8Z6K2|KPYK1_SALTI Pyruvate kinase I OS=Salmonella typhi GN=pykF PE=3 SV=1 1541 2020 5.0E-107
sp|Q49YC7|KPYK_STAS1 Pyruvate kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pyk PE=3 SV=1 1541 2023 5.0E-107
sp|P77983|KPYK1_SALTY Pyruvate kinase I OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pykF PE=3 SV=2 1541 2020 6.0E-107
sp|O08309|KPYK_CLOAB Pyruvate kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pyk PE=3 SV=2 1541 2023 6.0E-107
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 223 1466 1.0E-106
sp|P0AD61|KPYK1_ECOLI Pyruvate kinase I OS=Escherichia coli (strain K12) GN=pykF PE=1 SV=1 1541 2020 2.0E-106
sp|P0AD62|KPYK1_ECO57 Pyruvate kinase I OS=Escherichia coli O157:H7 GN=pykF PE=3 SV=1 1541 2020 2.0E-106
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 220 1466 4.0E-106
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 222 1468 2.0E-105
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 222 1466 2.0E-105
sp|Q6GG09|KPYK_STAAR Pyruvate kinase OS=Staphylococcus aureus (strain MRSA252) GN=pyk PE=1 SV=1 1541 2023 7.0E-105
sp|Q2YTE3|KPYK_STAAB Pyruvate kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pyk PE=3 SV=1 1541 2023 1.0E-104
sp|P51182|KPYK_SPOPS Pyruvate kinase OS=Sporosarcina psychrophila GN=pyk PE=3 SV=1 1541 2023 1.0E-104
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 222 1466 2.0E-104
sp|Q7A0N4|KPYK_STAAW Pyruvate kinase OS=Staphylococcus aureus (strain MW2) GN=pyk PE=3 SV=1 1541 2023 3.0E-104
sp|Q6G8M9|KPYK_STAAS Pyruvate kinase OS=Staphylococcus aureus (strain MSSA476) GN=pyk PE=3 SV=1 1541 2023 3.0E-104
sp|Q7A559|KPYK_STAAN Pyruvate kinase OS=Staphylococcus aureus (strain N315) GN=pyk PE=1 SV=1 1541 2023 3.0E-104
sp|Q99TG5|KPYK_STAAM Pyruvate kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pyk PE=3 SV=1 1541 2023 3.0E-104
sp|Q5HF76|KPYK_STAAC Pyruvate kinase OS=Staphylococcus aureus (strain COL) GN=pyk PE=3 SV=1 1541 2023 3.0E-104
sp|Q2FXM9|KPYK_STAA8 Pyruvate kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=pyk PE=3 SV=1 1541 2023 3.0E-104
sp|Q2FG40|KPYK_STAA3 Pyruvate kinase OS=Staphylococcus aureus (strain USA300) GN=pyk PE=3 SV=1 1541 2023 3.0E-104
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 225 1466 5.0E-104
sp|Q8CS69|KPYK_STAES Pyruvate kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pyk PE=3 SV=1 1541 2023 1.0E-103
sp|Q5HNK7|KPYK_STAEQ Pyruvate kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pyk PE=3 SV=1 1541 2023 1.0E-103
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 222 1468 2.0E-103
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 224 1466 8.0E-103
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 386 1466 3.0E-101
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 222 1454 2.0E-100
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 235 1466 5.0E-100
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 209 1468 6.0E-100
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 215 1466 7.0E-100
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 220 1466 1.0E-99
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 202 1466 1.0E-99
sp|Q4L739|KPYK_STAHJ Pyruvate kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pyk PE=3 SV=1 1541 2023 3.0E-99
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 367 1466 3.0E-98
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 210 1466 4.0E-98
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 397 1466 1.0E-97
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 367 1466 4.0E-97
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 210 1466 5.0E-97
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 367 1466 6.0E-97
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 206 1466 2.0E-95
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 220 1466 4.0E-95
sp|Q46289|KPYK_CLOPE Pyruvate kinase OS=Clostridium perfringens (strain 13 / Type A) GN=pykF PE=3 SV=2 1541 2023 1.0E-93
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 211 1466 3.0E-93
sp|P34038|KPYK_LACDE Pyruvate kinase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=pyk PE=1 SV=3 1541 2023 8.0E-93
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 232 1466 9.0E-92
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 220 1466 2.0E-91
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 229 1467 2.0E-91
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 217 1466 3.0E-91
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 233 1466 4.0E-91
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 225 1466 2.0E-90
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 225 1466 2.0E-90
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 219 1466 4.0E-90
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 223 1466 5.0E-90
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 470 1466 3.0E-87
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 470 1466 5.0E-87
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 218 1466 6.0E-87
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 470 1466 6.0E-87
sp|Q9PK61|KPYK_CHLMU Pyruvate kinase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=pyk PE=3 SV=1 1542 1969 9.0E-87
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 432 1466 2.0E-85
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 223 1466 2.0E-85
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 432 1466 3.0E-85
sp|Q9Z984|KPYK_CHLPN Pyruvate kinase OS=Chlamydia pneumoniae GN=pyk PE=3 SV=1 1542 1969 3.0E-85
sp|B0B7Q0|KPYK_CHLT2 Pyruvate kinase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=pyk PE=3 SV=1 1542 1970 6.0E-85
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 223 1466 6.0E-85
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 222 1446 8.0E-85
sp|P0CE21|KPYK_CHLTR Pyruvate kinase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=pyk PE=3 SV=1 1542 1970 1.0E-84
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 652 1446 2.0E-84
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 657 1466 2.0E-84
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 432 1466 2.0E-84
sp|P73534|KPYK2_SYNY3 Pyruvate kinase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pyk2 PE=3 SV=1 1541 2023 6.0E-84
sp|Q55863|KPYK1_SYNY3 Pyruvate kinase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pyk1 PE=3 SV=1 1541 1994 6.0E-84
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 218 1466 6.0E-84
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 658 1466 9.0E-84
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 222 1467 1.0E-82
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 657 1466 8.0E-81
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 611 1466 6.0E-80
sp|Q9FLW9|PKP2_ARATH Plastidial pyruvate kinase 2 OS=Arabidopsis thaliana GN=PKP2 PE=1 SV=1 1541 2009 8.0E-80
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 657 1467 1.0E-79
sp|Q07637|KPYK_LACLA Pyruvate kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pyk PE=3 SV=2 1541 2023 2.0E-79
sp|O51323|KPYK_BORBU Pyruvate kinase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=pyk PE=3 SV=1 1543 1965 2.0E-79
sp|Q8SQP0|KPYK_ENCCU Pyruvate kinase OS=Encephalitozoon cuniculi (strain GB-M1) GN=PYK1 PE=1 SV=2 1543 1974 2.0E-79
sp|Q46078|KPYK_CORGL Pyruvate kinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pyk PE=1 SV=1 1541 2023 4.0E-79
sp|Q9WY51|KPYK_THEMA Pyruvate kinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pyk PE=1 SV=1 1541 2027 8.0E-79
sp|Q2RAK2|KPYC1_ORYSJ Pyruvate kinase 1, cytosolic OS=Oryza sativa subsp. japonica GN=Os11g0148500 PE=1 SV=1 1527 2027 5.0E-78
sp|B8BJ39|KPYC1_ORYSI Pyruvate kinase 1, cytosolic OS=Oryza sativa subsp. indica GN=OsI_35105 PE=3 SV=1 1527 2027 5.0E-78
sp|Q40546|KPYG_TOBAC Pyruvate kinase isozyme G, chloroplastic OS=Nicotiana tabacum PE=2 SV=1 1541 2009 2.0E-77
sp|P43924|KPYK_HAEIN Pyruvate kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pykA PE=3 SV=2 1538 2022 2.0E-77
sp|Q2QXR8|KPYC2_ORYSJ Pyruvate kinase 2, cytosolic OS=Oryza sativa subsp. japonica GN=Os12g0145700 PE=2 SV=1 1527 2027 3.0E-77
sp|B8BM17|KPYC2_ORYSI Pyruvate kinase 2, cytosolic OS=Oryza sativa subsp. indica GN=OsI_37456 PE=3 SV=1 1527 2027 3.0E-77
sp|P70789|KPYK1_AGRVI Pyruvate kinase OS=Agrobacterium vitis GN=ttuE PE=2 SV=1 1538 2026 8.0E-77
sp|Q8FP04|KPYK_COREF Pyruvate kinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=pyk PE=3 SV=2 1541 2023 2.0E-76
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 173 1466 3.0E-76
sp|Q44473|KPYK2_AGRVI Pyruvate kinase OS=Agrobacterium vitis GN=ttuE PE=2 SV=1 1538 2025 7.0E-76
sp|Q93Z53|PKP3_ARATH Plastidial pyruvate kinase 3, chloroplastic OS=Arabidopsis thaliana GN=PKP3 PE=1 SV=1 1541 1974 2.0E-75
sp|P9WKE5|KPYK_MYCTU Pyruvate kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pyk PE=1 SV=1 1541 2025 1.0E-74
sp|P9WKE4|KPYK_MYCTO Pyruvate kinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pyk PE=3 SV=1 1541 2025 1.0E-74
sp|O05118|KPYK_METEA Pyruvate kinase OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=pyk PE=3 SV=2 1538 2030 1.0E-74
sp|Q8ZNW0|KPYK2_SALTY Pyruvate kinase II OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pykA PE=3 SV=3 1538 2024 2.0E-74
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 658 1493 5.0E-74
sp|P21599|KPYK2_ECOLI Pyruvate kinase II OS=Escherichia coli (strain K12) GN=pykA PE=1 SV=3 1538 2024 3.0E-73
sp|Q8K9M3|KPYK_BUCAP Pyruvate kinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=pykA PE=3 SV=1 1541 2025 5.0E-73
sp|P94939|KPYK_MYCIT Pyruvate kinase OS=Mycobacterium intracellulare GN=pyk PE=3 SV=1 1541 2025 1.0E-72
sp|P57404|KPYK_BUCAI Pyruvate kinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pykA PE=3 SV=1 1541 2025 2.0E-71
sp|Q89AI8|KPYK_BUCBP Pyruvate kinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=pykA PE=3 SV=1 1538 2025 4.0E-71
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 655 1466 6.0E-71
sp|Q43117|KPYA_RICCO Pyruvate kinase isozyme A, chloroplastic OS=Ricinus communis PE=1 SV=1 1538 1964 8.0E-69
sp|Q9LIK0|PKP1_ARATH Plastidial pyruvate kinase 1, chloroplastic OS=Arabidopsis thaliana GN=PKP1 PE=1 SV=1 1538 2008 1.0E-68
sp|P32044|KPYK_THEAC Pyruvate kinase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0896 PE=1 SV=2 1542 1989 1.0E-68
sp|Q40545|KPYA_TOBAC Pyruvate kinase isozyme A, chloroplastic OS=Nicotiana tabacum PE=2 SV=1 1468 1964 3.0E-67
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 909 1466 4.0E-65
sp|Q57572|KPYK_METJA Pyruvate kinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0108 PE=3 SV=1 1541 1976 2.0E-64
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 909 1466 1.0E-62
sp|Q56301|KPYK_THELN Pyruvate kinase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=pki PE=3 SV=2 1541 2023 1.0E-62
sp|P55964|KPYG_RICCO Pyruvate kinase isozyme G, chloroplastic (Fragment) OS=Ricinus communis PE=2 SV=1 1601 1975 4.0E-62
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 909 1466 1.0E-60
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 856 1466 5.0E-60
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 55 847 2.0E-59
sp|P47458|KPYK_MYCGE Pyruvate kinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pyk PE=3 SV=1 1541 1883 4.0E-58
sp|P78031|KPYK_MYCPN Pyruvate kinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pyk PE=3 SV=1 1541 1870 2.0E-56
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 909 1466 1.0E-55
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 281 850 1.0E-53
sp|Q9YEU2|KPYK_AERPE Pyruvate kinase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pyk PE=1 SV=1 1545 1964 1.0E-50
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 948 1466 1.0E-50
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 55 855 2.0E-50
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 1009 1467 2.0E-50
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 958 1466 3.0E-50
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 958 1466 3.0E-50
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 958 1466 3.0E-50
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 958 1466 3.0E-50
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 958 1466 3.0E-50
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 958 1466 6.0E-50
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 958 1466 8.0E-50
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 55 850 9.0E-50
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 958 1454 1.0E-49
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 961 1466 2.0E-48
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 961 1466 2.0E-48
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 55 855 3.0E-48
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 961 1466 4.0E-48
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 961 1454 1.0E-47
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 961 1466 2.0E-47
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 961 1466 3.0E-47
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 961 1466 4.0E-47
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 961 1466 4.0E-47
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 961 1466 4.0E-47
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 908 1466 9.0E-47
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 953 1477 1.0E-46
sp|P0CE68|NFT1_YEAST ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFT1 PE=3 SV=1 470 1164 2.0E-46
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 961 1454 2.0E-46
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 961 1466 2.0E-46
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 958 1466 2.0E-46
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 958 1466 2.0E-46
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 998 1466 3.0E-46
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 961 1466 3.0E-46
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 958 1466 4.0E-46
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 958 1466 4.0E-46
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 958 1466 7.0E-46
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 961 1449 2.0E-45
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 961 1466 2.0E-45
sp|O30853|KPYK1_PHOLE Pyruvate kinase I (Fragment) OS=Photobacterium leiognathi GN=pki PE=3 SV=1 1779 2023 7.0E-45
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 958 1466 1.0E-44
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 233 854 2.0E-44
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 961 1466 2.0E-44
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 958 1472 2.0E-44
sp|Q8ZYE0|KPYK_PYRAE Pyruvate kinase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pyk PE=1 SV=1 1546 1986 2.0E-44
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 961 1466 2.0E-44
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 233 854 7.0E-44
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 233 854 1.0E-43
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 233 854 2.0E-43
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 233 854 2.0E-43
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 233 854 2.0E-43
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 233 854 2.0E-43
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 961 1466 2.0E-43
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 233 854 3.0E-43
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 233 854 3.0E-43
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 962 1453 6.0E-43
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 961 1466 6.0E-43
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 233 854 7.0E-43
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 233 854 8.0E-43
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 233 854 8.0E-43
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 233 854 8.0E-43
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 233 854 8.0E-43
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 233 854 8.0E-43
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 233 854 8.0E-43
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 233 854 9.0E-43
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 233 854 9.0E-43
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 961 1466 9.0E-43
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 225 854 2.0E-42
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 233 854 3.0E-42
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 233 926 3.0E-42
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 233 854 4.0E-42
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 233 854 4.0E-42
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 961 1466 4.0E-42
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 961 1466 4.0E-42
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 961 1466 4.0E-42
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 233 854 5.0E-42
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 225 854 5.0E-42
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 233 854 6.0E-42
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 233 854 1.0E-41
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 233 854 2.0E-41
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 961 1449 2.0E-41
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 225 854 3.0E-41
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 233 854 1.0E-40
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 233 854 1.0E-40
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 233 854 2.0E-40
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 233 854 7.0E-40
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 233 854 9.0E-40
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 233 843 1.0E-39
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 225 843 2.0E-39
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 233 854 3.0E-39
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 225 854 3.0E-39
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 233 854 4.0E-39
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 226 841 3.0E-38
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 233 854 7.0E-38
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 225 843 2.0E-37
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 229 865 5.0E-35
sp|P0CE69|YK104_YEAST Putative uncharacterized protein YKR104W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR104W PE=5 SV=1 1233 1479 8.0E-31
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 1002 1480 1.0E-28
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 1234 1466 2.0E-28
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 989 1466 2.0E-27
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 989 1466 2.0E-27
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 989 1466 2.0E-27
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 657 1466 7.0E-27
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 657 1466 7.0E-27
sp|Q9M3B6|PKP4_ARATH Plastidial pyruvate kinase 4, chloroplastic OS=Arabidopsis thaliana GN=PKP4 PE=2 SV=1 1659 1867 2.0E-26
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 965 1466 3.0E-26
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 997 1466 6.0E-26
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 973 1466 7.0E-26
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 641 1466 1.0E-25
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 1121 1467 2.0E-25
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 641 1466 3.0E-25
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 1099 1492 6.0E-25
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 981 1466 1.0E-24
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 1098 1466 1.0E-24
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 1098 1466 1.0E-24
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 1155 1466 2.0E-24
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 949 1466 2.0E-24
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 1098 1466 3.0E-24
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 1098 1466 3.0E-24
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 1046 1466 4.0E-24
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 1210 1466 1.0E-23
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 1210 1466 1.0E-23
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 964 1466 1.0E-23
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 663 843 2.0E-23
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 979 1466 2.0E-23
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 1104 1466 2.0E-23
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 1069 1466 2.0E-23
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 1069 1466 2.0E-23
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 1217 1466 3.0E-23
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 1156 1466 4.0E-23
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 1156 1466 4.0E-23
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 1156 1466 4.0E-23
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 1156 1466 4.0E-23
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 1156 1466 4.0E-23
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 1156 1466 4.0E-23
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 1156 1466 4.0E-23
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 1156 1466 5.0E-23
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 1156 1466 5.0E-23
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 1156 1466 5.0E-23
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 1013 1475 5.0E-23
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 1156 1466 5.0E-23
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 1156 1466 7.0E-23
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 1156 1466 7.0E-23
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 955 1466 8.0E-23
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 1068 1466 1.0E-22
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 1068 1466 1.0E-22
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 1068 1466 1.0E-22
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 1068 1466 1.0E-22
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 1068 1466 1.0E-22
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 1068 1466 1.0E-22
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 1068 1466 1.0E-22
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 1068 1466 1.0E-22
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 1191 1466 1.0E-22
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 1156 1466 2.0E-22
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 1156 1466 2.0E-22
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 1156 1466 2.0E-22
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 1156 1466 2.0E-22
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 985 1497 2.0E-22
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 1069 1466 2.0E-22
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 1258 1466 2.0E-22
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 1014 1467 2.0E-22
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 1030 1466 2.0E-22
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 1003 1466 3.0E-22
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 1182 1466 4.0E-22
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 1068 1466 5.0E-22
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 1006 1466 6.0E-22
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 1107 1466 9.0E-22
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 978 1466 1.0E-21
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 1155 1466 1.0E-21
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 973 1466 1.0E-21
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 1016 1462 1.0E-21
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 1210 1467 1.0E-21
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 1022 1466 2.0E-21
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 958 1475 2.0E-21
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 982 1504 2.0E-21
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 1231 1467 3.0E-21
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 1071 1466 3.0E-21
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 1257 1466 3.0E-21
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 1107 1475 4.0E-21
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 1068 1467 4.0E-21
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 1261 1467 4.0E-21
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 1058 1466 5.0E-21
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 985 1466 5.0E-21
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 1241 1466 6.0E-21
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 978 1466 6.0E-21
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 978 1475 7.0E-21
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 648 875 7.0E-21
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 1218 1466 9.0E-21
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 1006 1466 9.0E-21
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 975 1466 1.0E-20
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 969 1466 2.0E-20
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 1196 1466 2.0E-20
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 479 847 2.0E-20
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 1003 1466 2.0E-20
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 978 1466 2.0E-20
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 1002 1466 3.0E-20
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 1239 1466 3.0E-20
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 1258 1466 4.0E-20
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 1107 1466 4.0E-20
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 1107 1466 4.0E-20
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 1272 1466 5.0E-20
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 659 870 6.0E-20
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 1231 1492 6.0E-20
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 1155 1466 6.0E-20
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 981 1466 6.0E-20
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 1155 1466 7.0E-20
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 1065 1466 7.0E-20
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 958 1466 7.0E-20
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 978 1466 8.0E-20
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 1264 1466 8.0E-20
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 1218 1466 9.0E-20
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 1021 1464 9.0E-20
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 1021 1464 9.0E-20
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 1259 1475 1.0E-19
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 1022 1466 1.0E-19
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 1021 1464 1.0E-19
sp|Q13W55|PSTB_BURXL Phosphate import ATP-binding protein PstB OS=Burkholderia xenovorans (strain LB400) GN=pstB PE=3 SV=1 1262 1482 1.0E-19
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 958 1475 1.0E-19
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 1187 1466 1.0E-19
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 1022 1466 2.0E-19
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 1068 1466 2.0E-19
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 1155 1466 2.0E-19
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 1194 1467 2.0E-19
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 988 1475 2.0E-19
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 1157 1466 2.0E-19
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 1213 1466 3.0E-19
sp|Q1BXC3|PSTB_BURCA Phosphate import ATP-binding protein PstB OS=Burkholderia cenocepacia (strain AU 1054) GN=pstB PE=3 SV=1 1262 1482 3.0E-19
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 1107 1466 3.0E-19
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 1257 1466 3.0E-19
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 996 1466 3.0E-19
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 996 1466 3.0E-19
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 996 1466 3.0E-19
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 1239 1466 4.0E-19
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 918 1466 4.0E-19
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 1161 1474 4.0E-19
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 1204 1466 4.0E-19
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 1196 1466 4.0E-19
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 1259 1466 4.0E-19
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 968 1466 5.0E-19
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 1241 1466 5.0E-19
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 1258 1466 6.0E-19
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 985 1454 6.0E-19
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 1237 1466 7.0E-19
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 1258 1466 8.0E-19
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 968 1466 9.0E-19
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 1014 1466 1.0E-18
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 1196 1466 1.0E-18
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 1237 1466 1.0E-18
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 1237 1466 1.0E-18
sp|Q5E3B8|PSTB2_VIBF1 Phosphate import ATP-binding protein PstB 2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pstB2 PE=3 SV=1 1262 1466 1.0E-18
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 1014 1466 1.0E-18
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 601 857 1.0E-18
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 977 1466 1.0E-18
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 977 1466 1.0E-18
sp|Q2SUW7|PSTB_BURTA Phosphate import ATP-binding protein PstB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pstB PE=3 SV=1 1262 1483 1.0E-18
sp|Q63V79|PSTB_BURPS Phosphate import ATP-binding protein PstB OS=Burkholderia pseudomallei (strain K96243) GN=pstB PE=3 SV=1 1262 1483 1.0E-18
sp|Q3JTS8|PSTB_BURP1 Phosphate import ATP-binding protein PstB OS=Burkholderia pseudomallei (strain 1710b) GN=pstB PE=3 SV=1 1262 1483 1.0E-18
sp|Q62L74|PSTB_BURMA Phosphate import ATP-binding protein PstB OS=Burkholderia mallei (strain ATCC 23344) GN=pstB PE=3 SV=1 1262 1483 1.0E-18
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 1240 1466 2.0E-18
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 1258 1466 2.0E-18
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 1107 1466 2.0E-18
sp|Q04668|KPYK_LEIBR Pyruvate kinase (Fragment) OS=Leishmania braziliensis PE=2 SV=1 1532 1615 2.0E-18
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 1157 1466 2.0E-18
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 977 1466 2.0E-18
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 1171 1466 2.0E-18
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 881 1466 2.0E-18
sp|Q663R5|PSTB2_YERPS Phosphate import ATP-binding protein PstB 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pstB2 PE=3 SV=1 1262 1493 2.0E-18
sp|Q1CCI2|PSTB2_YERPN Phosphate import ATP-binding protein PstB 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pstB2 PE=3 SV=1 1262 1493 2.0E-18
sp|Q8Z9T1|PSTB2_YERPE Phosphate import ATP-binding protein PstB 2 OS=Yersinia pestis GN=pstB2 PE=3 SV=1 1262 1493 2.0E-18
sp|Q1C0A2|PSTB2_YERPA Phosphate import ATP-binding protein PstB 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pstB2 PE=3 SV=1 1262 1493 2.0E-18
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 1210 1466 2.0E-18
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 1241 1466 2.0E-18
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 986 1466 2.0E-18
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 524 848 3.0E-18
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 524 848 3.0E-18
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 524 848 3.0E-18
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 524 848 3.0E-18
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 524 848 3.0E-18
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 524 848 3.0E-18
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 524 848 3.0E-18
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 524 848 3.0E-18
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 641 843 3.0E-18
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 1258 1466 3.0E-18
sp|Q39HM4|PSTB_BURL3 Phosphate import ATP-binding protein PstB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pstB PE=3 SV=1 1262 1482 3.0E-18
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 1196 1466 3.0E-18
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1196 1466 3.0E-18
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 1196 1466 3.0E-18
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 907 1467 4.0E-18
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 1196 1466 4.0E-18
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1196 1466 4.0E-18
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1196 1466 4.0E-18
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1196 1466 4.0E-18
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1196 1466 4.0E-18
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1196 1466 4.0E-18
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1196 1466 4.0E-18
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 1107 1466 4.0E-18
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 1204 1466 4.0E-18
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 639 854 4.0E-18
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 639 854 4.0E-18
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 639 854 4.0E-18
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 641 850 5.0E-18
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 1069 1466 5.0E-18
sp|Q21E72|PSTB_SACD2 Phosphate import ATP-binding protein PstB OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=pstB PE=3 SV=1 1262 1468 5.0E-18
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 1148 1466 5.0E-18
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 1002 1466 5.0E-18
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 1171 1466 5.0E-18
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 977 1466 5.0E-18
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 1238 1467 6.0E-18
sp|Q03203|NIST_LACLL Nisin transport ATP-binding protein NisT OS=Lactococcus lactis subsp. lactis GN=nisT PE=3 SV=1 1146 1467 6.0E-18
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 1019 1464 7.0E-18
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 1253 1465 7.0E-18
sp|Q3A6U0|PSTB_PELCD Phosphate import ATP-binding protein PstB OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pstB PE=3 SV=1 1262 1483 7.0E-18
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 1263 1466 8.0E-18
sp|Q7W8Q6|PSTB_BORPA Phosphate import ATP-binding protein PstB OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pstB PE=3 SV=2 1262 1483 9.0E-18
sp|Q7WMC3|PSTB_BORBR Phosphate import ATP-binding protein PstB OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pstB PE=3 SV=2 1262 1483 9.0E-18
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 973 1466 9.0E-18
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 1237 1466 9.0E-18
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 1237 1466 9.0E-18
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 1263 1466 1.0E-17
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 1196 1466 1.0E-17
sp|Q7VZ66|PSTB_BORPE Phosphate import ATP-binding protein PstB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pstB PE=3 SV=3 1262 1483 1.0E-17
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 1196 1466 1.0E-17
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 995 1466 1.0E-17
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 995 1466 1.0E-17
sp|Q2KVN7|PSTB_BORA1 Phosphate import ATP-binding protein PstB OS=Bordetella avium (strain 197N) GN=pstB PE=3 SV=1 1262 1483 1.0E-17
sp|Q2IGQ6|PSTB_ANADE Phosphate import ATP-binding protein PstB OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pstB PE=3 SV=1 1262 1467 1.0E-17
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 524 848 2.0E-17
sp|Q2L219|LOLD_BORA1 Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella avium (strain 197N) GN=lolD PE=3 SV=1 1265 1464 2.0E-17
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 1155 1466 2.0E-17
sp|Q8XZ72|PSTB_RALSO Phosphate import ATP-binding protein PstB OS=Ralstonia solanacearum (strain GMI1000) GN=pstB PE=3 SV=1 1262 1483 2.0E-17
sp|Q3YVL7|PSTB_SHISS Phosphate import ATP-binding protein PstB OS=Shigella sonnei (strain Ss046) GN=pstB PE=3 SV=1 1262 1468 2.0E-17
sp|P0AAH3|PSTB_SHIFL Phosphate import ATP-binding protein PstB OS=Shigella flexneri GN=pstB PE=3 SV=2 1262 1468 2.0E-17
sp|Q329R2|PSTB_SHIDS Phosphate import ATP-binding protein PstB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pstB PE=3 SV=1 1262 1468 2.0E-17
sp|Q31UX2|PSTB_SHIBS Phosphate import ATP-binding protein PstB OS=Shigella boydii serotype 4 (strain Sb227) GN=pstB PE=3 SV=1 1262 1468 2.0E-17
sp|Q1R4L0|PSTB_ECOUT Phosphate import ATP-binding protein PstB OS=Escherichia coli (strain UTI89 / UPEC) GN=pstB PE=3 SV=1 1262 1468 2.0E-17
sp|P0AAH0|PSTB_ECOLI Phosphate import ATP-binding protein PstB OS=Escherichia coli (strain K12) GN=pstB PE=1 SV=2 1262 1468 2.0E-17
sp|P0AAH1|PSTB_ECOL6 Phosphate import ATP-binding protein PstB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pstB PE=3 SV=2 1262 1468 2.0E-17
sp|Q0TAY4|PSTB_ECOL5 Phosphate import ATP-binding protein PstB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pstB PE=3 SV=1 1262 1468 2.0E-17
sp|P0AAH2|PSTB_ECO57 Phosphate import ATP-binding protein PstB OS=Escherichia coli O157:H7 GN=pstB PE=3 SV=2 1262 1468 2.0E-17
sp|Q57HY8|PSTB_SALCH Phosphate import ATP-binding protein PstB OS=Salmonella choleraesuis (strain SC-B67) GN=pstB PE=3 SV=1 1262 1468 2.0E-17
sp|Q8KDZ5|PSTB_CHLTE Phosphate import ATP-binding protein PstB OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=pstB PE=3 SV=1 1212 1466 2.0E-17
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 1263 1477 2.0E-17
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 1170 1466 2.0E-17
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 1170 1466 2.0E-17
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 1157 1466 2.0E-17
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 1263 1466 2.0E-17
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 1245 1467 3.0E-17
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 413 847 3.0E-17
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 1157 1466 3.0E-17
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 1022 1466 3.0E-17
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 1155 1466 3.0E-17
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 1157 1475 3.0E-17
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 624 854 3.0E-17
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 1264 1504 3.0E-17
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 1099 1466 3.0E-17
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 985 1466 4.0E-17
sp|Q6CYN3|PSTB2_PECAS Phosphate import ATP-binding protein PstB 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pstB2 PE=3 SV=1 1262 1468 4.0E-17
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 1070 1466 4.0E-17
sp|Q87S48|PSTB1_VIBPA Phosphate import ATP-binding protein PstB 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pstB1 PE=3 SV=1 1252 1468 4.0E-17
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 1220 1466 4.0E-17
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 1176 1466 4.0E-17
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 1259 1477 4.0E-17
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 1213 1466 4.0E-17
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 1196 1466 4.0E-17
sp|P0C2H2|MACB_ECOLX Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli GN=macB PE=3 SV=1 1243 1464 4.0E-17
sp|P0C2H3|MACB2_ECOK1 Macrolide export ATP-binding/permease protein MacB 2 OS=Escherichia coli O1:K1 / APEC GN=macB2 PE=3 SV=1 1243 1464 4.0E-17
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 1176 1466 4.0E-17
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 1194 1477 5.0E-17
sp|Q6LU82|PSTB1_PHOPR Phosphate import ATP-binding protein PstB 1 OS=Photobacterium profundum GN=pstB1 PE=3 SV=1 1262 1493 5.0E-17
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 1107 1466 5.0E-17
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 1019 1454 5.0E-17
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 1196 1466 6.0E-17
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 1196 1466 6.0E-17
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 1099 1466 6.0E-17
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 1099 1466 6.0E-17
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 1099 1466 6.0E-17
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 1239 1466 6.0E-17
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 1162 1466 7.0E-17
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 1196 1466 7.0E-17
sp|O32487|PSTB_ENTCL Phosphate import ATP-binding protein PstB OS=Enterobacter cloacae GN=pstB PE=3 SV=1 1262 1468 7.0E-17
sp|Q1GUY1|PSTB_SPHAL Phosphate import ATP-binding protein PstB OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=pstB PE=3 SV=1 1262 1451 7.0E-17
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 1264 1568 7.0E-17
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 1162 1466 7.0E-17
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 915 1490 1.0E-16
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 620 850 1.0E-16
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 624 854 2.0E-16
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 1253 1454 2.0E-16
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 482 849 3.0E-16
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 543 849 3.0E-16
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 543 849 3.0E-16
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 543 849 3.0E-16
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 632 845 5.0E-16
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 1261 1466 6.0E-16
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 980 1466 7.0E-16
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 1087 1466 7.0E-16
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 522 855 7.0E-16
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 1038 1489 8.0E-16
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 1038 1493 8.0E-16
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 408 859 8.0E-16
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 1111 1467 9.0E-16
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 657 854 1.0E-15
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 603 856 1.0E-15
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 638 854 1.0E-15
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 1107 1467 2.0E-15
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 871 1489 3.0E-15
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 641 850 3.0E-15
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 980 1466 4.0E-15
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 1260 1467 4.0E-15
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 544 848 4.0E-15
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 640 843 5.0E-15
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 1218 1466 7.0E-15
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 658 850 7.0E-15
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 1261 1466 8.0E-15
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 658 850 8.0E-15
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 641 850 9.0E-15
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 871 1487 1.0E-14
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 653 847 1.0E-14
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 1237 1466 1.0E-14
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 641 847 1.0E-14
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 641 847 1.0E-14
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 641 847 1.0E-14
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 640 864 1.0E-14
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 1268 1466 1.0E-14
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 641 867 1.0E-14
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 641 850 1.0E-14
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 1241 1466 1.0E-14
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 871 1467 2.0E-14
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 1261 1466 2.0E-14
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 641 850 2.0E-14
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 641 850 2.0E-14
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 1237 1466 3.0E-14
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 657 854 3.0E-14
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 1241 1466 3.0E-14
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 1256 1466 3.0E-14
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 1256 1466 3.0E-14
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 1256 1466 3.0E-14
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 908 1486 4.0E-14
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 1237 1466 4.0E-14
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 292 850 4.0E-14
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 649 879 4.0E-14
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 636 867 4.0E-14
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 417 850 5.0E-14
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 641 867 5.0E-14
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 641 867 5.0E-14
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 641 867 5.0E-14
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 641 867 5.0E-14
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 641 867 5.0E-14
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 641 867 5.0E-14
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 641 867 5.0E-14
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 632 874 6.0E-14
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 641 867 6.0E-14
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 641 867 6.0E-14
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 457 854 7.0E-14
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 653 847 7.0E-14
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 1261 1466 7.0E-14
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 1058 1467 8.0E-14
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 658 850 8.0E-14
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 658 850 8.0E-14
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 633 843 8.0E-14
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 908 1177 9.0E-14
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 641 847 9.0E-14
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 1106 1462 1.0E-13
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 543 849 1.0E-13
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 649 850 1.0E-13
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 649 850 1.0E-13
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 623 847 1.0E-13
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 1233 1542 2.0E-13
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 657 855 2.0E-13
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 1065 1466 2.0E-13
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 641 855 2.0E-13
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 1265 1466 2.0E-13
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 641 847 2.0E-13
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 1106 1462 3.0E-13
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 673 865 3.0E-13
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 641 850 3.0E-13
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 641 850 3.0E-13
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 644 864 3.0E-13
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 1106 1580 4.0E-13
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 519 843 4.0E-13
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 641 850 4.0E-13
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 1198 1463 5.0E-13
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 1261 1462 5.0E-13
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 535 845 5.0E-13
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 624 846 5.0E-13
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 636 843 5.0E-13
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 1106 1580 6.0E-13
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 644 850 7.0E-13
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 641 867 8.0E-13
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 1065 1492 1.0E-12
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 640 847 1.0E-12
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 641 850 1.0E-12
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 641 850 1.0E-12
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 641 850 1.0E-12
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 641 850 1.0E-12
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 641 850 1.0E-12
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 615 847 1.0E-12
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 615 847 1.0E-12
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 615 847 1.0E-12
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 1263 1466 1.0E-12
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 633 876 1.0E-12
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 634 847 1.0E-12
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 1259 1464 2.0E-12
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 1088 1466 2.0E-12
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 1207 1462 2.0E-12
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 1106 1462 2.0E-12
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 640 847 2.0E-12
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 645 850 2.0E-12
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 1225 1466 2.0E-12
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 641 911 2.0E-12
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 634 846 2.0E-12
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 1207 1462 3.0E-12
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 1106 1464 3.0E-12
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 649 850 3.0E-12
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 1264 1476 3.0E-12
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 649 860 3.0E-12
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 637 850 3.0E-12
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 1207 1464 4.0E-12
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 1106 1462 4.0E-12
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 1106 1464 4.0E-12
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 615 855 4.0E-12
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 615 855 4.0E-12
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 615 855 4.0E-12
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 615 855 4.0E-12
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 615 855 4.0E-12
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 615 855 4.0E-12
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 615 855 4.0E-12
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 1207 1462 5.0E-12
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 1207 1462 5.0E-12
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 615 855 5.0E-12
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 657 854 5.0E-12
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 1207 1462 6.0E-12
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 1207 1462 6.0E-12
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 1207 1462 6.0E-12
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 615 855 6.0E-12
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 658 848 6.0E-12
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 641 867 6.0E-12
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 641 881 6.0E-12
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 1207 1462 7.0E-12
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 1207 1462 7.0E-12
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 641 850 7.0E-12
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 1207 1462 8.0E-12
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 1207 1462 8.0E-12
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 489 846 8.0E-12
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 641 842 8.0E-12
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 1106 1569 9.0E-12
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 1207 1569 9.0E-12
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 1106 1569 9.0E-12
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 641 913 9.0E-12
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 641 849 9.0E-12
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 1207 1462 1.0E-11
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 1207 1462 1.0E-11
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 1207 1462 1.0E-11
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 1207 1462 1.0E-11
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 1207 1462 1.0E-11
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 1207 1462 1.0E-11
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 1106 1462 1.0E-11
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 1207 1462 1.0E-11
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 1225 1466 1.0E-11
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 1268 1466 1.0E-11
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 657 854 1.0E-11
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 638 842 1.0E-11
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 1064 1522 2.0E-11
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 1207 1462 2.0E-11
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 1207 1462 2.0E-11
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 1207 1462 2.0E-11
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 1261 1462 2.0E-11
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 404 860 2.0E-11
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 625 843 2.0E-11
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 625 843 2.0E-11
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 657 858 2.0E-11
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 1263 1466 2.0E-11
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 641 855 2.0E-11
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 621 860 2.0E-11
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 641 867 2.0E-11
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 1247 1466 3.0E-11
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 625 855 3.0E-11
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 641 843 3.0E-11
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 636 843 3.0E-11
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 649 855 3.0E-11
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 641 912 3.0E-11
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 641 867 3.0E-11
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 1207 1462 4.0E-11
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 640 854 4.0E-11
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 1263 1475 4.0E-11
sp|Q57HY8|PSTB_SALCH Phosphate import ATP-binding protein PstB OS=Salmonella choleraesuis (strain SC-B67) GN=pstB PE=3 SV=1 636 855 4.0E-11
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 1065 1472 5.0E-11
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 1065 1472 5.0E-11
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 649 846 5.0E-11
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 641 843 5.0E-11
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 1158 1485 5.0E-11
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 731 843 5.0E-11
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 1239 1471 6.0E-11
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 1207 1462 8.0E-11
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 411 850 8.0E-11
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 641 850 8.0E-11
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 625 850 8.0E-11
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 639 850 9.0E-11
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 641 884 1.0E-10
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 1207 1462 1.0E-10
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 631 843 1.0E-10
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 641 858 1.0E-10
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 640 855 1.0E-10
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 641 850 1.0E-10
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 641 850 1.0E-10
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 641 850 1.0E-10
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 658 850 1.0E-10
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 649 858 1.0E-10
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 641 889 1.0E-10
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 641 847 1.0E-10
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 641 848 1.0E-10
sp|Q3YVL7|PSTB_SHISS Phosphate import ATP-binding protein PstB OS=Shigella sonnei (strain Ss046) GN=pstB PE=3 SV=1 636 855 1.0E-10
sp|P0AAH3|PSTB_SHIFL Phosphate import ATP-binding protein PstB OS=Shigella flexneri GN=pstB PE=3 SV=2 636 855 1.0E-10
sp|Q329R2|PSTB_SHIDS Phosphate import ATP-binding protein PstB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pstB PE=3 SV=1 636 855 1.0E-10
sp|Q31UX2|PSTB_SHIBS Phosphate import ATP-binding protein PstB OS=Shigella boydii serotype 4 (strain Sb227) GN=pstB PE=3 SV=1 636 855 1.0E-10
sp|Q1R4L0|PSTB_ECOUT Phosphate import ATP-binding protein PstB OS=Escherichia coli (strain UTI89 / UPEC) GN=pstB PE=3 SV=1 636 855 1.0E-10
sp|P0AAH0|PSTB_ECOLI Phosphate import ATP-binding protein PstB OS=Escherichia coli (strain K12) GN=pstB PE=1 SV=2 636 855 1.0E-10
sp|P0AAH1|PSTB_ECOL6 Phosphate import ATP-binding protein PstB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pstB PE=3 SV=2 636 855 1.0E-10
sp|Q0TAY4|PSTB_ECOL5 Phosphate import ATP-binding protein PstB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pstB PE=3 SV=1 636 855 1.0E-10
sp|P0AAH2|PSTB_ECO57 Phosphate import ATP-binding protein PstB OS=Escherichia coli O157:H7 GN=pstB PE=3 SV=2 636 855 1.0E-10
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 645 850 2.0E-10
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 645 850 2.0E-10
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 645 850 2.0E-10
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 641 876 2.0E-10
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 657 843 2.0E-10
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 641 845 2.0E-10
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 649 847 2.0E-10
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 641 850 2.0E-10
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 649 855 2.0E-10
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 639 843 2.0E-10
sp|Q87S48|PSTB1_VIBPA Phosphate import ATP-binding protein PstB 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pstB1 PE=3 SV=1 624 854 2.0E-10
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 649 858 3.0E-10
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 658 843 3.0E-10
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 626 843 3.0E-10
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 649 847 4.0E-10
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 625 850 4.0E-10
sp|Q3A6U0|PSTB_PELCD Phosphate import ATP-binding protein PstB OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pstB PE=3 SV=1 639 855 4.0E-10
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 649 847 6.0E-10
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 649 858 7.0E-10
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 731 848 8.0E-10
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 731 848 8.0E-10
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 1260 1466 9.0E-10
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 641 860 9.0E-10
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 641 843 9.0E-10
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 625 850 9.0E-10
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 731 848 9.0E-10
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 657 843 1.0E-09
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 641 867 1.0E-09
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 641 850 1.0E-09
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 648 841 1.0E-09
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 641 858 1.0E-09
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 641 854 1.0E-09
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 658 855 1.0E-09
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 649 847 1.0E-09
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 426 847 2.0E-09
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 624 848 2.0E-09
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 624 842 2.0E-09
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 624 842 2.0E-09
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 624 848 2.0E-09
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 624 848 2.0E-09
sp|Q2L219|LOLD_BORA1 Lipoprotein-releasing system ATP-binding protein LolD OS=Bordetella avium (strain 197N) GN=lolD PE=3 SV=1 657 836 2.0E-09
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 625 843 3.0E-09
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 657 850 3.0E-09
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 641 843 3.0E-09
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 640 855 3.0E-09
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 649 855 3.0E-09
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 545 854 3.0E-09
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 634 843 3.0E-09
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 625 850 3.0E-09
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 641 883 4.0E-09
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 649 843 4.0E-09
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 649 842 5.0E-09
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 525 863 6.0E-09
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 1255 1486 7.0E-09
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 566 843 7.0E-09
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 1263 1466 8.0E-09
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 614 843 8.0E-09
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 632 855 9.0E-09
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 649 847 9.0E-09
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 1258 1467 1.0E-08
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 525 853 1.0E-08
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 651 861 1.0E-08
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 641 861 1.0E-08
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 1262 1466 1.0E-08
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 215 595 1.0E-08
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 1106 1462 1.0E-08
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 632 855 1.0E-08
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 632 855 1.0E-08
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 649 847 1.0E-08
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 657 843 1.0E-08
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 641 870 2.0E-08
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 433 858 2.0E-08
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 640 858 2.0E-08
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 641 841 2.0E-08
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 641 858 2.0E-08
sp|Q2SUW7|PSTB_BURTA Phosphate import ATP-binding protein PstB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pstB PE=3 SV=1 641 797 2.0E-08
sp|Q63V79|PSTB_BURPS Phosphate import ATP-binding protein PstB OS=Burkholderia pseudomallei (strain K96243) GN=pstB PE=3 SV=1 641 797 2.0E-08
sp|Q3JTS8|PSTB_BURP1 Phosphate import ATP-binding protein PstB OS=Burkholderia pseudomallei (strain 1710b) GN=pstB PE=3 SV=1 641 797 2.0E-08
sp|Q62L74|PSTB_BURMA Phosphate import ATP-binding protein PstB OS=Burkholderia mallei (strain ATCC 23344) GN=pstB PE=3 SV=1 641 797 2.0E-08
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 641 858 2.0E-08
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 641 850 2.0E-08
sp|O32487|PSTB_ENTCL Phosphate import ATP-binding protein PstB OS=Enterobacter cloacae GN=pstB PE=3 SV=1 636 841 2.0E-08
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 637 859 3.0E-08
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 649 847 3.0E-08
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 649 841 3.0E-08
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 641 869 3.0E-08
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 641 858 3.0E-08
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 651 855 5.0E-08
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 627 847 5.0E-08
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 643 847 5.0E-08
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 657 843 5.0E-08
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 657 843 5.0E-08
sp|Q5E3B8|PSTB2_VIBF1 Phosphate import ATP-binding protein PstB 2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pstB2 PE=3 SV=1 624 848 5.0E-08
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 641 858 5.0E-08
sp|Q2KVN7|PSTB_BORA1 Phosphate import ATP-binding protein PstB OS=Bordetella avium (strain 197N) GN=pstB PE=3 SV=1 641 836 5.0E-08
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 641 842 6.0E-08
sp|Q6LU82|PSTB1_PHOPR Phosphate import ATP-binding protein PstB 1 OS=Photobacterium profundum GN=pstB1 PE=3 SV=1 624 865 6.0E-08
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 636 841 7.0E-08
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 653 910 8.0E-08
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 655 845 8.0E-08
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 641 843 9.0E-08
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 656 861 1.0E-07
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 641 853 1.0E-07
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 641 859 1.0E-07
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 655 847 1.0E-07
sp|Q7VZ66|PSTB_BORPE Phosphate import ATP-binding protein PstB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pstB PE=3 SV=3 637 854 1.0E-07
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 1088 1503 2.0E-07
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 649 847 2.0E-07
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 633 847 2.0E-07
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 641 858 2.0E-07
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 649 841 2.0E-07
sp|Q7W8Q6|PSTB_BORPA Phosphate import ATP-binding protein PstB OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pstB PE=3 SV=2 641 854 2.0E-07
sp|Q7WMC3|PSTB_BORBR Phosphate import ATP-binding protein PstB OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pstB PE=3 SV=2 641 854 2.0E-07
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 1095 1492 3.0E-07
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 641 861 3.0E-07
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 649 847 3.0E-07
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 649 847 3.0E-07
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 641 843 3.0E-07
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 1259 1420 4.0E-07
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 632 847 4.0E-07
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 222 598 4.0E-07
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 641 855 5.0E-07
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 641 855 7.0E-07
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 1060 1520 8.0E-07
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 640 849 8.0E-07
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 1095 1476 8.0E-07
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 653 844 8.0E-07
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 1254 1466 2.0E-06
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 641 859 2.0E-06
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 653 844 2.0E-06
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 640 850 2.0E-06
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 634 862 3.0E-06
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 625 855 4.0E-06
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 1273 1464 5.0E-06
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 641 847 7.0E-06
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 641 875 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0000287 magnesium ion binding Yes
GO:0006096 glycolytic process Yes
GO:0140359 ABC-type transporter activity Yes
GO:0004743 pyruvate kinase activity Yes
GO:0030955 potassium ion binding Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0046034 ATP metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0051234 establishment of localization No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0046939 nucleotide phosphorylation No
GO:0110165 cellular anatomical entity No
GO:1901564 organonitrogen compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0009056 catabolic process No
GO:0005575 cellular_component No
GO:0097367 carbohydrate derivative binding No
GO:0016052 carbohydrate catabolic process No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0019752 carboxylic acid metabolic process No
GO:0008150 biological_process No
GO:0140657 ATP-dependent activity No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0016740 transferase activity No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0046031 ADP metabolic process No
GO:0000166 nucleotide binding No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0006091 generation of precursor metabolites and energy No
GO:1901575 organic substance catabolic process No
GO:0003824 catalytic activity No
GO:0009117 nucleotide metabolic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0044281 small molecule metabolic process No
GO:0009132 nucleoside diphosphate metabolic process No
GO:0043168 anion binding No
GO:0046872 metal ion binding No
GO:0032553 ribonucleotide binding No
GO:0009185 ribonucleoside diphosphate metabolic process No
GO:0031420 alkali metal ion binding No
GO:1901135 carbohydrate derivative metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0015399 primary active transmembrane transporter activity No
GO:0006753 nucleoside phosphate metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043169 cation binding No
GO:0006165 nucleoside diphosphate phosphorylation No
GO:0071704 organic substance metabolic process No
GO:0009179 purine ribonucleoside diphosphate metabolic process No
GO:0006757 ATP generation from ADP No
GO:0006163 purine nucleotide metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0072521 purine-containing compound metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0009135 purine nucleoside diphosphate metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0022857 transmembrane transporter activity No
GO:0006082 organic acid metabolic process No
GO:0022804 active transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0016310 phosphorylation No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0006810 transport No
GO:0051179 localization No
GO:0006090 pyruvate metabolic process No
GO:0043167 ion binding No
GO:0006793 phosphorus metabolic process No
GO:0005488 binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032787 monocarboxylic acid metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 62 84 22
2 96 118 22
3 128 150 22
4 155 177 22
5 182 204 22
6 299 321 22
7 336 353 17
8 432 454 22
9 927 949 22
10 969 991 22
11 1057 1079 22
12 1149 1171 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3193
MRDGRLGMRRGAGSKGEAIDRIDDEGEHRTRSLMARWRLSPQDTSFGPRLQGRFDFTLVFEQAVFSIGPSAVLLL
ASPFRIVSLAQRKPNSGANALLWFKLICILLLFGLRLAIFALWTVSSPALRTQLTLAAASLSLADAVAMWSLLYA
EHRYSYSPSILLSLYLSVTVLLDIASVRSLFLRGGLIAVAVMSAAAVIVKLLLLALEEVPKRQLSVFTASKETSS
GLWNRSAFWWLNSTFYKGYTAFLQVDDLPSLDHKLDSRRLVSSLDREWKSINKFIKHPLASATFSAFKATFWAAV
IPRLCYTAFSFAQPFLINTVVKFLGAPRPDDSRSVVGGLIAATALVYLGIAVSKCHFMHHTFRLITSVRGGLVGL
IFAKVINLEGTTANDSVAVTLMSTDIDGIAGGLQDIHDIWVSFIELGLGVFLLQRQLGAVCFLVLIPAILSSIAT
TRVAQGMGPAKALWNSKVQKRVSTTSSVLSQIKGIKMMGINDRISHVIQFLRVSELDSSKSFRIFSVWMNMIANL
ADQLTPILVISAAVFWTNGGQNLSVAEAFTSISIVVLVSTPVVKLISAYPTFVASLACFERIQAFLLLAERKDYR
YDISSLCGDSSKSRKQDRGVGVRPLEVTSFLRDESEAAPAIRIKNASFFPRSGNDVILKDINLTIHRSTLTIVMG
PVGSGKSALLKAILGEVRLQTGSVQLNCGRVAYCDQVPWLRLGSLRDNILGPNGHDEAWYRKVLWACALDEDVAQ
LEDGDRSLVGSSGLALSGGQKQRVALARAVYARTPVILLDDAFNSLDRKTAIDVFSRLLGTEGLLRREGTTILLA
SHSLEHLSCADDIVVLDESGTVVNRTASDDPIRLSEACRTGLDFDPDKVQYLDAGDPGDDKPVTGLSQEKATAQN
ASTDELTRKTGDISLYKFYFKSVGPWLFTGWLLFAAGYIFSGKVPQIWLRVWTENGTMNRTAAYFGGYLGFGVLS
ALLSGFCVFYFMIVVVPKSAQHLHWLLLDSVFKAPFWVFTTTDLSSILNRFSQDMTLVDQVLPMAAFTTTFDVFN
VIAETGLIASGATYVAAVIPLCVLAIYAIQKYYLRTSRQMRLLDLEAKNPLYRQFTETAAGIVTVRAFGWEADMI
EEHLQQLDYSQKPYYMMCCIQRWLNVVLDLFVAALTIVLVGFALGFSSAATQGSIGLAMLNVVEFSQSLSKLINS
WTGLETSLGAIARLKDFLAETKAEDAETDKKIPPDGWPASGSILMAGVTAKYNIDDSQSQPAIRNVDLKLGAGQK
IVIVGRTGSGKSSLILALLGMLDLESGRIVVDGLDTSHVSRQALRSRIVVIPQDAVELPGTVRQNLGLFESMDLD
EAMQRALVRVGLWDTVKKRGGLDGELCEIGLSGGQKQLFSLARALVTGQRVAAKNRGGIVLLDEPTSSVDKKTEA
EMQRIVAEEFASYTSITVSHRPEAAREADVAVRMCDGRVAEVSLRSFVVKLRTTEEEDEEEEKATKRHLLDAASL
SVSSRSFNVMAAAQQDHLNGGGRINWLASLDTAYKPERNYRRSSIICTIGPVTNSVEKINSLRDAGLNVVRMNFS
HGTYDYHQSVIDAARKAVECHPGRPVAIALDTKGPEIRTGNTKDDADLPISAGTVLNITTDDKYAKTCDTENMYV
DYKNITKVIEPGRIIYVDDGVLAFEVLSIKDDKTIQVRARNNGFISSRKGVNLPNTDVDLPALSEKDKADLQFGV
KNKVDMVFASFIRRAQDIRDIRKVLGEQGKDIQIIAKIENRQGLNNFKEILEETDGVMVARGDLGIEIPAAEVFA
AQKKLIAMCNLAGKPVICATQMLESMIKNPRPTRAEISDVGNAITDGADCVMLSGETAKGAYPTEAVREMHEACL
KAENTIPYVSHFEEMCTLVQRPVSTVESCAMAAVRASLDLGAGGIIVLSTSGESARLLSKYRPVCPIFMVTRNAT
TSRFGHLYRGVYPFLFPEAKPDFEKVNWQEDVDRRIKWAVDQALKLKTLTIGDMVVVVQGWKGGMGNTNTLRIVR
ADPEHLGIGQP
Coding >Ophio5|3193
ATGAGAGACGGCAGGCTAGGAATGAGGCGAGGGGCAGGCTCTAAAGGCGAAGCCATTGACCGGATTGATGATGAG
GGGGAACATAGAACTCGCTCGCTGATGGCGCGTTGGAGACTGTCGCCTCAGGACACCTCCTTCGGCCCGCGGCTG
CAGGGGCGCTTCGACTTTACCCTCGTCTTTGAACAGGCCGTCTTCTCCATCGGACCGTCTGCCGTCCTGCTACTT
GCCTCGCCGTTCCGTATTGTGTCCCTGGCCCAGAGGAAGCCGAATTCTGGGGCCAACGCCTTGCTCTGGTTCAAG
CTCATCTGCATTCTACTCCTATTCGGTCTTCGCCTGGCCATCTTTGCGCTATGGACCGTCTCTTCGCCGGCTCTG
CGCACCCAACTTACGTTGGCGGCTGCCAGCCTGTCGCTCGCGGATGCCGTGGCCATGTGGTCGCTGCTTTATGCC
GAGCATCGCTACTCTTACTCGCCCTCCATTCTGCTAAGTCTGTACTTGTCTGTCACGGTTCTTCTCGACATTGCC
AGTGTCCGCTCCCTTTTCCTCCGAGGCGGCTTGATTGCTGTCGCAGTCATGAGCGCGGCCGCTGTTATTGTCAAG
CTTCTGCTGCTCGCGCTCGAAGAAGTTCCTAAGCGGCAACTTTCCGTCTTCACCGCATCCAAGGAGACTTCGAGC
GGCTTGTGGAACCGCTCTGCCTTTTGGTGGCTGAACTCGACGTTCTACAAGGGCTACACTGCCTTCCTTCAAGTT
GATGACCTGCCTAGCCTGGACCATAAGCTGGACTCCCGCCGTCTTGTCTCCAGCCTGGATCGGGAATGGAAGTCG
ATTAATAAGTTCATCAAGCATCCACTGGCTTCTGCTACTTTTTCTGCGTTCAAGGCCACTTTCTGGGCTGCGGTC
ATTCCTAGACTCTGCTACACGGCTTTCTCCTTTGCACAACCCTTTCTCATCAACACGGTAGTCAAGTTTCTTGGG
GCTCCGCGGCCTGACGACTCCCGGAGCGTGGTTGGGGGGCTCATTGCGGCCACGGCTTTGGTTTATCTTGGGATC
GCGGTCTCGAAATGTCACTTTATGCATCATACTTTCCGCCTCATCACCTCCGTTCGAGGCGGGCTTGTCGGACTT
ATATTTGCCAAAGTCATAAATCTAGAGGGTACTACGGCCAATGACTCTGTCGCTGTAACTCTAATGAGCACCGAT
ATTGACGGAATCGCTGGCGGATTGCAGGACATTCATGATATATGGGTAAGCTTCATTGAGCTGGGTCTGGGTGTC
TTTCTGCTCCAACGGCAGCTTGGCGCGGTTTGCTTCCTGGTTCTTATTCCTGCTATCCTGTCAAGTATCGCAACT
ACCCGTGTGGCTCAAGGCATGGGGCCCGCCAAAGCACTATGGAATTCAAAGGTGCAGAAGCGAGTCTCGACCACA
TCATCGGTCCTAAGCCAGATCAAGGGCATCAAGATGATGGGGATCAATGACCGCATTTCCCACGTCATCCAGTTC
CTTCGTGTCTCCGAACTTGACTCCTCGAAAAGCTTCCGTATTTTCTCTGTCTGGATGAACATGATAGCCAATCTC
GCCGATCAACTGACTCCAATCCTAGTCATTTCCGCGGCCGTCTTTTGGACCAATGGCGGCCAGAACCTGAGCGTC
GCCGAAGCCTTCACTTCGATTTCAATCGTTGTCCTTGTTTCGACCCCAGTAGTGAAGCTCATCTCGGCGTATCCC
ACCTTTGTTGCAAGCTTGGCATGCTTCGAGCGCATACAGGCTTTCCTCCTCCTCGCGGAGAGAAAAGACTATCGT
TACGATATCTCCTCCCTCTGTGGGGACTCCTCAAAGAGCAGGAAACAGGACAGAGGTGTTGGTGTCAGGCCCCTA
GAGGTCACAAGTTTTCTACGTGACGAGTCAGAGGCGGCGCCGGCCATCCGTATCAAGAATGCTTCATTCTTCCCG
CGGAGCGGCAATGACGTGATCCTCAAGGACATTAACCTTACCATACACAGGTCGACCCTGACAATAGTTATGGGC
CCGGTCGGCTCGGGAAAATCGGCACTCCTCAAGGCGATCCTTGGTGAAGTGCGACTACAGACCGGCTCGGTGCAA
CTAAACTGTGGCCGTGTAGCGTACTGCGACCAGGTCCCTTGGTTACGACTTGGTTCATTGCGGGATAACATACTG
GGACCGAATGGCCATGATGAGGCATGGTACCGAAAAGTCCTCTGGGCTTGTGCCTTGGACGAAGACGTTGCTCAG
CTTGAGGATGGAGACCGGTCTCTTGTTGGCAGTAGCGGCCTCGCGCTGAGTGGAGGGCAGAAGCAGAGAGTGGCC
CTCGCGAGAGCCGTATATGCCCGGACGCCGGTCATTCTATTAGACGACGCCTTCAATTCTCTTGATAGAAAGACG
GCTATCGACGTATTTAGCCGTCTGCTCGGCACTGAAGGACTCTTAAGGAGGGAGGGCACGACTATTCTATTGGCT
AGTCACTCGTTGGAACACCTGTCATGTGCGGATGACATTGTTGTCCTGGATGAGAGTGGCACCGTGGTGAATCGC
ACAGCGTCTGATGACCCGATCCGACTGAGTGAAGCTTGCCGTACAGGTCTCGACTTCGACCCGGACAAGGTTCAA
TATCTTGATGCAGGAGACCCAGGGGACGACAAGCCTGTCACAGGCCTTTCACAGGAAAAAGCCACCGCTCAAAAT
GCCTCTACTGACGAGCTGACGAGAAAGACTGGAGACATCAGCTTGTATAAATTTTACTTCAAGTCTGTTGGCCCT
TGGCTGTTCACTGGCTGGCTTCTGTTCGCCGCAGGCTACATCTTTTCGGGCAAGGTACCTCAGATATGGCTTCGG
GTCTGGACGGAAAATGGGACCATGAATCGTACAGCGGCCTATTTCGGAGGCTACCTGGGTTTTGGCGTGCTGTCC
GCCCTACTTTCAGGATTCTGCGTCTTTTACTTCATGATCGTCGTGGTCCCAAAATCTGCTCAACACCTACACTGG
CTCTTGCTCGACAGTGTCTTCAAGGCGCCGTTTTGGGTTTTTACGACAACCGATTTAAGCTCAATTTTGAACCGC
TTCAGTCAGGACATGACATTGGTGGACCAAGTTCTTCCGATGGCTGCCTTTACAACGACGTTTGACGTGTTCAAT
GTGATTGCAGAAACAGGGCTCATAGCGTCTGGAGCAACCTACGTCGCGGCCGTGATACCGCTTTGTGTCTTGGCC
ATCTACGCGATCCAGAAGTATTACCTTCGAACGTCCCGTCAGATGCGGCTGCTGGACCTGGAAGCCAAAAATCCC
TTGTACCGACAATTCACGGAAACAGCGGCGGGCATCGTCACAGTTCGTGCTTTTGGCTGGGAAGCGGATATGATA
GAGGAGCATCTTCAGCAGCTTGATTACTCCCAGAAGCCCTACTACATGATGTGCTGCATCCAACGGTGGCTGAAC
GTGGTGCTTGACCTCTTCGTTGCAGCCCTGACCATTGTGCTGGTCGGCTTCGCGCTGGGCTTCTCCAGTGCGGCA
ACGCAGGGCTCCATTGGGCTCGCCATGCTGAACGTGGTCGAGTTCAGCCAGAGTCTTTCGAAGCTCATCAATTCG
TGGACCGGACTGGAGACGTCTCTCGGCGCCATCGCCAGGCTCAAGGATTTTCTCGCCGAGACAAAGGCCGAGGAC
GCGGAGACGGACAAGAAGATACCGCCTGACGGATGGCCGGCAAGCGGCTCGATACTGATGGCGGGCGTCACGGCA
AAGTATAATATCGATGACTCCCAATCGCAGCCAGCCATCCGCAACGTCGACCTGAAACTAGGCGCTGGGCAGAAG
ATTGTGATAGTGGGAAGGACGGGCAGTGGCAAGTCGTCGCTTATCCTGGCGCTTTTGGGTATGCTGGACTTGGAG
TCCGGGCGCATAGTCGTCGACGGTCTGGATACGTCACACGTCTCCCGTCAAGCGCTTCGTTCCCGAATCGTCGTG
ATACCCCAAGACGCCGTCGAGCTCCCGGGGACGGTAAGGCAGAACCTCGGCCTATTCGAATCGATGGACTTGGAC
GAGGCAATGCAGCGCGCACTGGTCCGCGTCGGACTGTGGGACACGGTGAAGAAGCGGGGCGGGCTGGATGGCGAG
CTCTGCGAGATCGGGCTATCCGGTGGGCAGAAGCAGCTGTTTTCTCTGGCGCGGGCCCTCGTGACAGGGCAGCGA
GTAGCGGCCAAGAATAGGGGCGGCATCGTGCTACTGGACGAGCCGACGAGCAGCGTGGACAAGAAGACGGAGGCG
GAGATGCAAAGGATCGTCGCCGAAGAGTTTGCCAGCTACACCTCCATCACCGTGAGCCATCGGCCAGAGGCGGCC
CGGGAGGCGGATGTGGCGGTGCGCATGTGTGACGGGCGGGTGGCTGAGGTCTCGCTGAGAAGCTTCGTTGTGAAA
CTGCGAACGACAGAAGAAGAAGACGAGGAAGAAGAAAAAGCAACGAAAAGGCATCTGCTCGACGCCGCCTCTCTG
TCTGTCAGCTCTCGATCCTTCAACGTCATGGCCGCTGCTCAACAGGACCATCTCAATGGCGGTGGCCGCATCAAC
TGGCTGGCCTCGCTCGACACCGCCTACAAGCCCGAGCGTAATTACCGCCGCTCCTCTATCATCTGCACCATCGGG
CCCGTCACCAACTCGGTCGAAAAGATCAACAGCCTTCGCGACGCCGGCCTCAACGTCGTCCGCATGAACTTTTCC
CATGGAACCTACGACTACCATCAGTCTGTTATCGATGCCGCCCGTAAGGCCGTCGAATGCCACCCTGGCCGGCCC
GTCGCCATTGCCCTCGACACCAAGGGGCCTGAGATTCGCACGGGCAACACCAAGGACGACGCCGACCTGCCTATT
TCCGCCGGCACAGTCTTGAACATAACCACGGATGACAAGTATGCTAAGACGTGCGATACGGAGAACATGTATGTC
GACTACAAGAACATCACAAAGGTCATCGAGCCCGGCCGCATCATCTACGTCGACGATGGGGTCCTTGCCTTCGAA
GTGCTTAGCATCAAGGATGACAAAACGATCCAGGTCCGCGCCCGCAACAACGGCTTCATCTCGTCGAGAAAGGGC
GTCAACCTGCCCAACACGGACGTCGACCTGCCCGCCCTTTCGGAAAAGGACAAGGCCGACCTCCAGTTTGGCGTC
AAGAACAAGGTGGACATGGTCTTTGCCTCGTTTATCCGTCGTGCGCAGGACATTCGCGACATCCGCAAGGTTCTC
GGTGAACAAGGCAAGGACATTCAGATTATTGCCAAGATTGAGAACCGCCAGGGCCTCAACAACTTCAAGGAGATT
CTTGAGGAGACGGACGGGGTCATGGTAGCCCGCGGAGATCTCGGCATCGAGATCCCCGCGGCCGAGGTGTTTGCG
GCGCAGAAGAAGCTCATTGCCATGTGCAACCTGGCTGGCAAGCCCGTCATCTGCGCGACGCAGATGCTTGAGTCG
ATGATCAAGAATCCGCGGCCGACGCGAGCGGAGATTAGCGACGTGGGCAACGCCATCACGGACGGGGCCGACTGC
GTCATGCTCTCGGGCGAGACGGCCAAGGGCGCCTACCCGACTGAGGCGGTGCGCGAGATGCACGAGGCCTGCCTC
AAGGCGGAGAACACGATCCCATACGTGTCGCACTTTGAAGAGATGTGCACGCTGGTTCAGCGACCCGTGTCGACG
GTGGAGTCGTGCGCTATGGCGGCTGTACGCGCGTCGCTGGATCTTGGCGCGGGCGGCATCATCGTGTTGTCCACG
TCGGGGGAGTCGGCCAGGCTGCTGTCCAAGTACCGGCCGGTGTGCCCCATCTTCATGGTGACGCGCAATGCGACG
ACGTCGCGCTTCGGCCACCTGTATCGCGGCGTCTACCCCTTCCTCTTCCCCGAGGCCAAGCCCGACTTTGAAAAG
GTTAACTGGCAGGAGGACGTGGACCGGCGCATCAAGTGGGCCGTGGATCAGGCGCTGAAGCTCAAAACGCTGACG
ATTGGCGACATGGTGGTCGTGGTTCAGGGCTGGAAGGGCGGCATGGGCAACACGAACACGCTGCGGATCGTGCGG
GCCGACCCTGAGCACCTGGGCATTGGCCAACCC
Transcript >Ophio5|3193
ATGAGAGACGGCAGGCTAGGAATGAGGCGAGGGGCAGGCTCTAAAGGCGAAGCCATTGACCGGATTGATGATGAG
GGGGAACATAGAACTCGCTCGCTGATGGCGCGTTGGAGACTGTCGCCTCAGGACACCTCCTTCGGCCCGCGGCTG
CAGGGGCGCTTCGACTTTACCCTCGTCTTTGAACAGGCCGTCTTCTCCATCGGACCGTCTGCCGTCCTGCTACTT
GCCTCGCCGTTCCGTATTGTGTCCCTGGCCCAGAGGAAGCCGAATTCTGGGGCCAACGCCTTGCTCTGGTTCAAG
CTCATCTGCATTCTACTCCTATTCGGTCTTCGCCTGGCCATCTTTGCGCTATGGACCGTCTCTTCGCCGGCTCTG
CGCACCCAACTTACGTTGGCGGCTGCCAGCCTGTCGCTCGCGGATGCCGTGGCCATGTGGTCGCTGCTTTATGCC
GAGCATCGCTACTCTTACTCGCCCTCCATTCTGCTAAGTCTGTACTTGTCTGTCACGGTTCTTCTCGACATTGCC
AGTGTCCGCTCCCTTTTCCTCCGAGGCGGCTTGATTGCTGTCGCAGTCATGAGCGCGGCCGCTGTTATTGTCAAG
CTTCTGCTGCTCGCGCTCGAAGAAGTTCCTAAGCGGCAACTTTCCGTCTTCACCGCATCCAAGGAGACTTCGAGC
GGCTTGTGGAACCGCTCTGCCTTTTGGTGGCTGAACTCGACGTTCTACAAGGGCTACACTGCCTTCCTTCAAGTT
GATGACCTGCCTAGCCTGGACCATAAGCTGGACTCCCGCCGTCTTGTCTCCAGCCTGGATCGGGAATGGAAGTCG
ATTAATAAGTTCATCAAGCATCCACTGGCTTCTGCTACTTTTTCTGCGTTCAAGGCCACTTTCTGGGCTGCGGTC
ATTCCTAGACTCTGCTACACGGCTTTCTCCTTTGCACAACCCTTTCTCATCAACACGGTAGTCAAGTTTCTTGGG
GCTCCGCGGCCTGACGACTCCCGGAGCGTGGTTGGGGGGCTCATTGCGGCCACGGCTTTGGTTTATCTTGGGATC
GCGGTCTCGAAATGTCACTTTATGCATCATACTTTCCGCCTCATCACCTCCGTTCGAGGCGGGCTTGTCGGACTT
ATATTTGCCAAAGTCATAAATCTAGAGGGTACTACGGCCAATGACTCTGTCGCTGTAACTCTAATGAGCACCGAT
ATTGACGGAATCGCTGGCGGATTGCAGGACATTCATGATATATGGGTAAGCTTCATTGAGCTGGGTCTGGGTGTC
TTTCTGCTCCAACGGCAGCTTGGCGCGGTTTGCTTCCTGGTTCTTATTCCTGCTATCCTGTCAAGTATCGCAACT
ACCCGTGTGGCTCAAGGCATGGGGCCCGCCAAAGCACTATGGAATTCAAAGGTGCAGAAGCGAGTCTCGACCACA
TCATCGGTCCTAAGCCAGATCAAGGGCATCAAGATGATGGGGATCAATGACCGCATTTCCCACGTCATCCAGTTC
CTTCGTGTCTCCGAACTTGACTCCTCGAAAAGCTTCCGTATTTTCTCTGTCTGGATGAACATGATAGCCAATCTC
GCCGATCAACTGACTCCAATCCTAGTCATTTCCGCGGCCGTCTTTTGGACCAATGGCGGCCAGAACCTGAGCGTC
GCCGAAGCCTTCACTTCGATTTCAATCGTTGTCCTTGTTTCGACCCCAGTAGTGAAGCTCATCTCGGCGTATCCC
ACCTTTGTTGCAAGCTTGGCATGCTTCGAGCGCATACAGGCTTTCCTCCTCCTCGCGGAGAGAAAAGACTATCGT
TACGATATCTCCTCCCTCTGTGGGGACTCCTCAAAGAGCAGGAAACAGGACAGAGGTGTTGGTGTCAGGCCCCTA
GAGGTCACAAGTTTTCTACGTGACGAGTCAGAGGCGGCGCCGGCCATCCGTATCAAGAATGCTTCATTCTTCCCG
CGGAGCGGCAATGACGTGATCCTCAAGGACATTAACCTTACCATACACAGGTCGACCCTGACAATAGTTATGGGC
CCGGTCGGCTCGGGAAAATCGGCACTCCTCAAGGCGATCCTTGGTGAAGTGCGACTACAGACCGGCTCGGTGCAA
CTAAACTGTGGCCGTGTAGCGTACTGCGACCAGGTCCCTTGGTTACGACTTGGTTCATTGCGGGATAACATACTG
GGACCGAATGGCCATGATGAGGCATGGTACCGAAAAGTCCTCTGGGCTTGTGCCTTGGACGAAGACGTTGCTCAG
CTTGAGGATGGAGACCGGTCTCTTGTTGGCAGTAGCGGCCTCGCGCTGAGTGGAGGGCAGAAGCAGAGAGTGGCC
CTCGCGAGAGCCGTATATGCCCGGACGCCGGTCATTCTATTAGACGACGCCTTCAATTCTCTTGATAGAAAGACG
GCTATCGACGTATTTAGCCGTCTGCTCGGCACTGAAGGACTCTTAAGGAGGGAGGGCACGACTATTCTATTGGCT
AGTCACTCGTTGGAACACCTGTCATGTGCGGATGACATTGTTGTCCTGGATGAGAGTGGCACCGTGGTGAATCGC
ACAGCGTCTGATGACCCGATCCGACTGAGTGAAGCTTGCCGTACAGGTCTCGACTTCGACCCGGACAAGGTTCAA
TATCTTGATGCAGGAGACCCAGGGGACGACAAGCCTGTCACAGGCCTTTCACAGGAAAAAGCCACCGCTCAAAAT
GCCTCTACTGACGAGCTGACGAGAAAGACTGGAGACATCAGCTTGTATAAATTTTACTTCAAGTCTGTTGGCCCT
TGGCTGTTCACTGGCTGGCTTCTGTTCGCCGCAGGCTACATCTTTTCGGGCAAGGTACCTCAGATATGGCTTCGG
GTCTGGACGGAAAATGGGACCATGAATCGTACAGCGGCCTATTTCGGAGGCTACCTGGGTTTTGGCGTGCTGTCC
GCCCTACTTTCAGGATTCTGCGTCTTTTACTTCATGATCGTCGTGGTCCCAAAATCTGCTCAACACCTACACTGG
CTCTTGCTCGACAGTGTCTTCAAGGCGCCGTTTTGGGTTTTTACGACAACCGATTTAAGCTCAATTTTGAACCGC
TTCAGTCAGGACATGACATTGGTGGACCAAGTTCTTCCGATGGCTGCCTTTACAACGACGTTTGACGTGTTCAAT
GTGATTGCAGAAACAGGGCTCATAGCGTCTGGAGCAACCTACGTCGCGGCCGTGATACCGCTTTGTGTCTTGGCC
ATCTACGCGATCCAGAAGTATTACCTTCGAACGTCCCGTCAGATGCGGCTGCTGGACCTGGAAGCCAAAAATCCC
TTGTACCGACAATTCACGGAAACAGCGGCGGGCATCGTCACAGTTCGTGCTTTTGGCTGGGAAGCGGATATGATA
GAGGAGCATCTTCAGCAGCTTGATTACTCCCAGAAGCCCTACTACATGATGTGCTGCATCCAACGGTGGCTGAAC
GTGGTGCTTGACCTCTTCGTTGCAGCCCTGACCATTGTGCTGGTCGGCTTCGCGCTGGGCTTCTCCAGTGCGGCA
ACGCAGGGCTCCATTGGGCTCGCCATGCTGAACGTGGTCGAGTTCAGCCAGAGTCTTTCGAAGCTCATCAATTCG
TGGACCGGACTGGAGACGTCTCTCGGCGCCATCGCCAGGCTCAAGGATTTTCTCGCCGAGACAAAGGCCGAGGAC
GCGGAGACGGACAAGAAGATACCGCCTGACGGATGGCCGGCAAGCGGCTCGATACTGATGGCGGGCGTCACGGCA
AAGTATAATATCGATGACTCCCAATCGCAGCCAGCCATCCGCAACGTCGACCTGAAACTAGGCGCTGGGCAGAAG
ATTGTGATAGTGGGAAGGACGGGCAGTGGCAAGTCGTCGCTTATCCTGGCGCTTTTGGGTATGCTGGACTTGGAG
TCCGGGCGCATAGTCGTCGACGGTCTGGATACGTCACACGTCTCCCGTCAAGCGCTTCGTTCCCGAATCGTCGTG
ATACCCCAAGACGCCGTCGAGCTCCCGGGGACGGTAAGGCAGAACCTCGGCCTATTCGAATCGATGGACTTGGAC
GAGGCAATGCAGCGCGCACTGGTCCGCGTCGGACTGTGGGACACGGTGAAGAAGCGGGGCGGGCTGGATGGCGAG
CTCTGCGAGATCGGGCTATCCGGTGGGCAGAAGCAGCTGTTTTCTCTGGCGCGGGCCCTCGTGACAGGGCAGCGA
GTAGCGGCCAAGAATAGGGGCGGCATCGTGCTACTGGACGAGCCGACGAGCAGCGTGGACAAGAAGACGGAGGCG
GAGATGCAAAGGATCGTCGCCGAAGAGTTTGCCAGCTACACCTCCATCACCGTGAGCCATCGGCCAGAGGCGGCC
CGGGAGGCGGATGTGGCGGTGCGCATGTGTGACGGGCGGGTGGCTGAGGTCTCGCTGAGAAGCTTCGTTGTGAAA
CTGCGAACGACAGAAGAAGAAGACGAGGAAGAAGAAAAAGCAACGAAAAGGCATCTGCTCGACGCCGCCTCTCTG
TCTGTCAGCTCTCGATCCTTCAACGTCATGGCCGCTGCTCAACAGGACCATCTCAATGGCGGTGGCCGCATCAAC
TGGCTGGCCTCGCTCGACACCGCCTACAAGCCCGAGCGTAATTACCGCCGCTCCTCTATCATCTGCACCATCGGG
CCCGTCACCAACTCGGTCGAAAAGATCAACAGCCTTCGCGACGCCGGCCTCAACGTCGTCCGCATGAACTTTTCC
CATGGAACCTACGACTACCATCAGTCTGTTATCGATGCCGCCCGTAAGGCCGTCGAATGCCACCCTGGCCGGCCC
GTCGCCATTGCCCTCGACACCAAGGGGCCTGAGATTCGCACGGGCAACACCAAGGACGACGCCGACCTGCCTATT
TCCGCCGGCACAGTCTTGAACATAACCACGGATGACAAGTATGCTAAGACGTGCGATACGGAGAACATGTATGTC
GACTACAAGAACATCACAAAGGTCATCGAGCCCGGCCGCATCATCTACGTCGACGATGGGGTCCTTGCCTTCGAA
GTGCTTAGCATCAAGGATGACAAAACGATCCAGGTCCGCGCCCGCAACAACGGCTTCATCTCGTCGAGAAAGGGC
GTCAACCTGCCCAACACGGACGTCGACCTGCCCGCCCTTTCGGAAAAGGACAAGGCCGACCTCCAGTTTGGCGTC
AAGAACAAGGTGGACATGGTCTTTGCCTCGTTTATCCGTCGTGCGCAGGACATTCGCGACATCCGCAAGGTTCTC
GGTGAACAAGGCAAGGACATTCAGATTATTGCCAAGATTGAGAACCGCCAGGGCCTCAACAACTTCAAGGAGATT
CTTGAGGAGACGGACGGGGTCATGGTAGCCCGCGGAGATCTCGGCATCGAGATCCCCGCGGCCGAGGTGTTTGCG
GCGCAGAAGAAGCTCATTGCCATGTGCAACCTGGCTGGCAAGCCCGTCATCTGCGCGACGCAGATGCTTGAGTCG
ATGATCAAGAATCCGCGGCCGACGCGAGCGGAGATTAGCGACGTGGGCAACGCCATCACGGACGGGGCCGACTGC
GTCATGCTCTCGGGCGAGACGGCCAAGGGCGCCTACCCGACTGAGGCGGTGCGCGAGATGCACGAGGCCTGCCTC
AAGGCGGAGAACACGATCCCATACGTGTCGCACTTTGAAGAGATGTGCACGCTGGTTCAGCGACCCGTGTCGACG
GTGGAGTCGTGCGCTATGGCGGCTGTACGCGCGTCGCTGGATCTTGGCGCGGGCGGCATCATCGTGTTGTCCACG
TCGGGGGAGTCGGCCAGGCTGCTGTCCAAGTACCGGCCGGTGTGCCCCATCTTCATGGTGACGCGCAATGCGACG
ACGTCGCGCTTCGGCCACCTGTATCGCGGCGTCTACCCCTTCCTCTTCCCCGAGGCCAAGCCCGACTTTGAAAAG
GTTAACTGGCAGGAGGACGTGGACCGGCGCATCAAGTGGGCCGTGGATCAGGCGCTGAAGCTCAAAACGCTGACG
ATTGGCGACATGGTGGTCGTGGTTCAGGGCTGGAAGGGCGGCATGGGCAACACGAACACGCTGCGGATCGTGCGG
GCCGACCCTGAGCACCTGGGCATTGGCCAACCCTGA
Gene >Ophio5|3193
ATGAGAGACGGCAGGCTAGGAATGAGGCGAGGGGCAGGCTCTAAAGGCGAAGCCATTGACCGGATTGATGATGAG
GGGGAACATAGAACGTGATATCAGACGTGTGATATGCACGAATCGGGGCACAATGCTGACCACGGCATTGTAGTC
GCTCGCTGATGGCGCGTTGGAGACTGTCGCCTCAGGGTCAGCATCGATGAAAGAGAGCCTTCCGCGGCCCGGCGC
CGACCGACTCTCGCTCACCAAGTTCCATCACCACCGATAGAGCGGACATCACATGCAATGAACACGGCAGCAGAC
ACCTCCTTCGGCCCGCGGCTGCAGGGGCGCTTCGACTTTACCCTCGTCTTTGAACAGGCCGTCTTCTCCATCGGA
CCGTCTGCCGTCCTGCTACTTGCCTCGCCGTTCCGTATTGTGTCCCTGGCCCAGAGGAAGCCGAATTCTGGGGCC
AACGCCTTGCTCTGGTTCAAGCTCGTGAGCCTCTTTCTGCCCGGCTTCGATACTGTGCTTACTCCAGAAAGATCT
GCATTCTACTCCTATTCGGTCTTCGCCTGGCCATCTTTGCGCTATGGACCGTCTCTTCGCCGGCTCTGCGCACCC
AACTTACGTTGGCGGCTGCCAGCCTGTCGCTCGCGGATGCCGTGGCCATGTGGTCGCTGCTTTATGCCGAGCATC
GCTACTCTTACTCGCCCTCCATTCTGCTAAGTCTGTACTTGTCTGTCACGGTTCTTCTCGACATTGCCAGTGTCC
GCTCCCTTTTCCTCCGAGGCGGCTTGATTGCTGTCGCAGTCATGAGCGCGGCCGCTGTTATTGTCAAGCTTCTGC
TGCTCGCGCTCGAAGAAGTTCCTAAGCGGCAACTTTCCGTCTTCACCGCATCCAAGGAGACTTCGAGCGGCTTGT
GGAACCGCTCTGCCTTTTGGTGGCTGAACTCGACGTTCTACAAGGGCTACACTGCCTTCCTTCAAGTTGATGACC
TGCCTAGCCTGGACCATAAGCTGGACTCCCGCCGTCTTGTCTCCAGCCTGGATCGGGAATGGAAGTCGAGTAAGT
CGGCAGCAGTGCTTCTAGTCGCCGCTGCCATCCATACTGAGTCGAAAACCAGTTAATAAGTTCATCAAGCATCCA
CTGGCTTCTGCTACTTTTTCTGCGTTCAAGGCCACTTTCTGGGCTGCGGTCATTCCTAGACTCTGCTACACGGCT
TTCTCCTTTGCACAACCCTTTCTCATCAACACGGTAGTCAAGTTTCTTGGGGCTCCGCGGCCTGACGACTCCCGG
AGCGTGGTTGGGGGGCTCATTGCGGCCACGGCTTTGGTTTATCTTGGGATCGCGGTACGTCGAGTCTTTTCTTTC
ACCGTTTTTTTTTATTGCTGAAACGGTATCAGGTCTCGAAATGTCACTTTATGCATCATACTTTCCGCCTCATCA
CCTCCGTTCGAGGCGGGCTTGTCGGACTTATATTTGCCAAAGTCATAAATCTAGAGGGTACTACGGCCAATGACT
CTGTCGCTGTAACTCTAATGAGCACCGATATTGACGGAATCGCTGGCGGATTGCAGGACATTCATGATATATGGG
TAAGCTTCATTGAGCTGGGTCTGGGTGTCTTTCTGCTCCAACGGCAGCTTGGCGCGGTTTGCTTCCTGGTTCTTA
TTCCTGCTATCCGTACGTCAGACTTCTCCCAGCATTGGATCAGGGCTCTATTCCCTACGAGTTATGCTGACCGTG
ACGCCGTGAAGTGTCAAGTATCGCAACTACCCGTGTGGCTCAAGGCATGGGGCCCGCCAAAGCACTATGGAATTC
AAAGGTGCAGAAGCGAGTCTCGACCACATCATCGGTCCTAAGCCAGATCAAGGGCATCAAGATGATGGGGATCAA
TGACCGCATTTCCCACGTCATCCAGTTCCTTCGTGTCTCCGAACTTGACTCCTCGAAAAGCTTCCGTATTTTCTC
TGTCTGGATGAACATGATAGGTGCCACTTCCTGTTCCAACTGGCCGGGTCGCTGCCATCTGTGTTGCTGACGTCT
ATGCTGTATGTAGCCAATCTCGCCGATCAACTGACTCCAATCCTAGTCATTTCCGCGGCCGTCTTTTGGACCAAT
GGCGGCCAGAACCTGAGCGTCGCCGAAGCCTTCACTTCGATTTCAATCGTTGTCCTTGTTTCGACCCCAGTAGTG
AAGCTCATCTCGGCGTATCCCACCTTTGTTGCAAGCTTGGCATGCTTCGAGCGCATACAGGCTTTCCTCCTCCTC
GCGGAGAGAAAAGACTATCGTTACGATATCTCCTCCCTCTGTGGGGACTCCTCAAAGAGCAGGAAACAGGACAGA
GGTGTTGGTGTCAGGCCCCTAGAGGTCACAAGTTTTCTACGTGACGAGTCAGAGGCGGCGCCGGCCATCCGTATC
AAGAATGCTTCATTCTTCCCGCGGAGCGGCAATGACGTGATCCTCAAGGACATTAACCTTACCATACACAGGTCG
ACCCTGACAATAGTTATGGGCCCGGTCGGCTCGGGAAAATCGGCACTCCTCAAGGCGATCCTTGGTGAAGTGCGA
CTACAGACCGGCTCGGTGCAACTAAACTGTGGCCGTGTAGCGTACTGCGACCAGGTCCCTTGGTTACGACTTGGT
TCATTGCGGGATAACATACTGGGACCGAATGGCCATGATGAGGCATGGTACCGAAAAGTCCTCTGGGCTTGTGCC
TTGGACGAAGACGTTGCTCAGCTTGAGGATGGAGACCGGTCTCTTGTTGGCAGTAGCGGCCTCGCGCTGAGTGGA
GGGCAGAAGCAGAGAGTGGTATGTGCCCTTCGAGCGGTGGCTCTTCGAGCGGTACTGATCAAAGTGCGTTTCCAG
GCCCTCGCGAGAGCCGTATATGCCCGGACGCCGGTCATTCTATTAGACGACGCCTTCAATTCTCTTGATAGAAAG
ACGGCTATCGACGTATTTAGCCGTCTGCTCGGCACTGAAGGACTCTTAAGGAGGGAGGGCACGACTATTCTATTG
GCTAGTCACTCGTGTAGGGCTCCTCACTCAATCGAGACCCTTGCCTCACTTCACTTAACATGGAACTGACAGTCA
TTAGTGGAACACCTGTCATGTGCGGATGACATTGTTGTCCTGGATGAGAGTGGCACCGTGGTGAATCGCACAGCG
TCTGATGACCCGATCCGACTGAGTGAAGCTTGCCGTACAGGTCTCGACTTCGACCCGGACAAGGTTCAATATCTT
GATGCAGGAGACCCAGGGGACGACAAGCCTGTCACAGGCCTTTCACAGGAAAAAGCCACCGCTCAAAATGCCTCT
ACTGACGAGCTGACGAGAAAGACTGGAGACATCAGCTTGTATAAATTTTACTTCAAGTCTGTTGGCCCTTGGCTG
TTCACTGGCTGGCTTCTGTTCGCCGCAGGCTACATCTTTTCGGGCAAGGTACCTCGTACGTTTTCTCTGATTTCC
TCTCCTGTTGCTCCCCACTCACACCGGACACAAAACAGAGATATGGCTTCGGGTCTGGACGGAAAATGGGACCAT
GAATCGTACAGCGGCCTATTTCGGAGGCTACCTGGGTTTTGGCGTGCTGTCCGCCCTACTTTCAGGATTCTGCGT
CTTGTCAGTCACTCGTTGGTCAGAAGGGGAAGCTGTCGTCTCTGACTGAGTCTTGCAGTTACTTCATGATCGTCG
TGGTCCCAAAATCTGCTCAACACCTACACTGGCTCTTGCTCGACAGTGTCTTCAAGTAGGTTGACTCACGAGTTA
TGGAGGCTTGAGTCTTGCTCATGGTGGGCTCAGGGCGCCGTTTTGGGTTTTTACGACAACCGATTTAAGCTCAAT
TTTGAACCGGTACGTTACAGCAGAGCCGAAGAGTTGGCGTGAGCTCATCTCTTTGGCAGCTTCAGTCAGGACATG
ACATTGGTGGACCAAGTTCTTCCGATGGCTGCCTTTACAACGACGTTTGGTAGGCATAACAGCCCATGATCATAT
GCTCTTTGAAGCTAACAAGACACTCGCAGACGTGTTCAATGTGATTGCAGAAACAGGGCTCATAGCGTCTGGAGC
AACCTACGTCGCGGCCGTGATACCGCTTTGTGTCTTGGCCATCTACGCGATCCAGAAGTATTACCTTCGAACGTC
CCGTCAGATGCGGCTGCTGGACCTGGAAGCCAAAAATCCCTTGTACCGACAATTCACGGAAACAGCGGCGGGCAT
CGTCACAGTTCGTGCTTTTGGCTGGGAAGCGGATATGATAGAGGAGCATCTTCAGCAGCTTGATTACTCCCAGAA
GCCCTACTACATGATGTGAGCTTACGCTGACATGACGGGGGGTGAATGAACGTCAGGATGACTGACTGGACACGA
ATTTTAGGTGCTGCATCCAACGGTGGCTGAACGTGGTGCTTGACCTCTTCGTTGCAGCCCTGACCATTGTGCTGG
TCGGCTTCGCGCTGGGCTTCTCCAGTGCGGCAACGCAGGGCTCCATTGGGCTCGCCATGCTGAACGTGGTCGAGT
TCAGCCAGAGTCTTTCGAAGCTCATCAATTCGTGGACCGGACTGGAGACGTCTCTCGGCGCCATCGCCAGGCTCA
AGGATTTTCTCGCCGAGACAAAGGCCGAGGACGCGGAGACGGACAAGAAGATACCGCCTGACGGATGGCCGGCAA
GCGGCTCGATACTGATGGCGGGCGTCACGGCAAAGTATAAGTATGTCGTCATGGCTGCTGATGACAGTATGGGAG
TCAAGCTAACAGTAGGGCCAAATAGTATCGATGACTCCCAATCGCAGCCAGCCATCCGCAACGTCGACCTGAAAC
TAGGCGCTGGGCAGAAGATTGTGATAGTGGGAAGGACGGGCAGTGGCAAGTCGTCGCTTATCCTGGCGCTTTTGG
GTATGCTGGACTTGGAGTCCGGGCGCATAGTCGTCGACGGTCTGGATACGTCACACGTCTCCCGTCAAGCGCTTC
GTTCCCGAATCGTCGTGATACCCCAAGACGCCGTCGAGCTCCCGGGGACGGTAAGGCAGAACCTCGGCCTATTCG
AATCGATGGACTTGGACGAGGCAATGCAGCGCGCACTGGTCCGCGTCGGACTGTGGGACACGGTGAAGAAGCGGG
GCGGGCTGGATGGCGAGCTCTGCGAGATCGGGCTATCCGGTGGGCAGAAGCAGCTGTTTTCTCTGGCGCGGGCCC
TCGTGACAGGGCAGCGAGTAGCGGCCAAGAATAGGGGCGGCATCGTGCTACTGGACGAGCCGACGAGCAGCGTGG
ACAAGAAGACGGAGGCGGAGATGCAAAGGATCGTCGCCGAAGAGTTTGCCAGCTACACCTCCATCACCGTGAGCC
ATCGGCCAGAGGCGGCCCGGGAGGCGGATGTGGCGGTGCGCATGTGTGACGGGCGGGTGGCTGAGGTCTCGCTGA
GGTGAGGGAAGCTTAAGCTGTGTACTTGCTGTGACCTTATCTCTCCCGCTTATCTCCTTCGAAACCTAAGGCCAA
AGGGGCACGGGCCGCAAAGGAGGGGCAGCTTCTCGCCCCCACCACAATAAAAAAAAAGCAGGACCACGATCTGCT
CTCATCTCTTCTTTCTTCTTTTCTTCCCCCTCCCCTCCCCCCCATCGTCTCTGTCTCGCTGTTGAATTCGACTCC
GTGGCTCAGTGAACGATTTGCGCCGAGCTTCGACTACCTGTGTACCCCGAGCTACATCCTTCAATAGCCGGCTGT
ACCTTTTTGGCAGCTAGCAGAAGCTTCGTTGTGAAACTGCGAACGACAGAAGAAGAAGACGAGGAAGAAGAAAAA
GCAACGAAAAGGGTGCGGCTCTCTCCCTCTGCCAGCTGCGTCAGTTCAACCAAGTGAAGCTCATCCCTTCCAATA
GCATCTGCTCGACGCCGCCTCTCTGTCTGTCAGCTCTCGATCCTTCAAGTAAGGACATCTCGCTTCCCGTCATCT
TCCGTCAACATGGCCCAGAATCCCAACCGCTCCCGCTCATTTAGCGTCATGGCCGCTGCTCAACAGGACCATCTC
AATGGCGGTGGCCGCATCAACTGGCTGGCCTCGCTCGACACCGCCTACAAGCCCGAGCGTAATTACCGCCGCTCC
TCTATCATCTGCACCATCGGGCCCGTCACCAACTCGGTCGAAAAGATCAACAGCCTTCGCGACGCCGGCCTCAAC
GTCGTCCGCATGAACTTTTCCCATGGAACCTACGACTACCATCAGTCTGTTATCGATGCCGCCCGTAAGGCCGTC
GAATGCCACCCTGGCCGGCCCGTCGCCATTGCCCTCGACACCAAGGGGCCTGAGATTCGCACGGGCAACACCAAG
GACGACGCCGACCTGCCTATTTCCGCCGGCACAGTCTTGAACATAACCACGGATGACAAGTATGCTAAGACGTGC
GATACGGAGAACATGTAAGTCATGAAGCCATTTCTCAAGCCGGGGCTCGAGTATCTTACCTGCATCACAGGTATG
TCGACTACAAGAACATCACAAAGGTCATCGAGCCCGGCCGCATCATCTACGTCGACGATGGGGTCCTTGCCTTCG
AAGTGCTTAGCATCAAGGATGACAAAACGATCCAGGTCCGCGCCCGCAACAACGGCTTCATCTCGTCGAGAAAGG
GCGTCAACCTGCCCAACACGGACGTCGACCTGCCCGCCCTTTCGGAAAAGGACAAGGCCGACCTCCAGTTTGGCG
TCAAGAACAAGGTGGACATGGTCTTTGCCTCGTTTATCCGTCGTGCGCAGGACATTCGCGACATCCGCAAGGTTC
TCGGTGAACAAGGCAAGGACATTCAGATTATTGCCAAGATTGAGAACCGCCAGGGCCTCAACAACTTCAAGGAGA
TTCTTGAGGAGACGGACGGGGTCATGGTAGCCCGCGGAGATCTCGGCATCGAGATCCCCGCGGCCGAGGTGTTTG
CGGCGCAGAAGAAGCTCATTGCCATGTGCAACCTGGCTGGCAAGCCCGTCATCTGCGCGACGCAGATGCTTGAGT
CGATGATCAAGAATCCGCGGCCGACGCGAGCGGAGATTAGCGACGTGGGCAACGCCATCACGGACGGGGCCGACT
GCGTCATGCTCTCGGGCGAGACGGCCAAGGGCGCCTACCCGACTGAGGCGGTGCGCGAGATGCACGAGGCCTGCC
TCAAGGCGGAGAACACGATCCCATACGTGTCGCACTTTGAAGAGATGTGCACGCTGGTTCAGCGACCCGTGTCGA
CGGTGGAGTCGTGCGCTATGGCGGCTGTACGCGCGTCGCTGGATCTTGGCGCGGGCGGCATCATCGTGTTGTCCA
CGTCGGGGGAGTCGGCCAGGCTGCTGTCCAAGTACCGGCCGGTGTGCCCCATCTTCATGGTGACGCGCAATGCGA
CGACGTCGCGCTTCGGCCACCTGTATCGCGGCGTCTACCCCTTCCTCTTCCCCGAGGCCAAGCCCGACTTTGAAA
AGGTTAACTGGCAGGAGGACGTGGACCGGCGCATCAAGTGGGCCGTGGATCAGGCGCTGAAGCTCAAAACGCTGA
CGATTGGCGACATGGTGGTCGTGGTTCAGGGCTGGAAGGGCGGCATGGGCAACACGAACACGCTGCGGATCGTGC
GGGCCGACCCTGAGCACCTGGGCATTGGCCAACCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail