Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3179
Gene name
Locationscaffold_251:8523..12117
Strand+
Gene length (bp)3594
Transcript length (bp)3483
Coding sequence length (bp)3480
Protein length (aa) 1160

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 3.9E-09 552 666
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 4.3E-15 969 1116
PF03733 YccF Inner membrane component domain 3.7E-16 280 333

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 109 758 4.0E-148
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 217 752 3.0E-110
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 950 1124 8.0E-61
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 941 1127 1.0E-56
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 962 1121 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 109 758 4.0E-148
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 217 752 3.0E-110
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 950 1124 8.0E-61
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 941 1127 1.0E-56
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 962 1121 5.0E-17
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 970 1121 2.0E-14
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 552 670 3.0E-12
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 554 668 3.0E-11
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 967 1121 4.0E-11
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 550 674 5.0E-10
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 970 1121 5.0E-09
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 554 678 1.0E-08
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 554 671 3.0E-08
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 975 1120 4.0E-08
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 950 1122 5.0E-08
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 979 1120 6.0E-08
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 985 1120 1.0E-07
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 550 674 1.0E-07
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 548 674 2.0E-07
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 966 1121 3.0E-07
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 971 1120 4.0E-07
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 552 677 6.0E-07
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 552 669 1.0E-06
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 552 678 2.0E-06
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 979 1120 2.0E-06
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 975 1120 2.0E-06
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 552 662 3.0E-06
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 958 1120 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 288 310 22
2 425 447 22
3 451 468 17
4 519 538 19
5 548 570 22
6 583 605 22
7 615 637 22
8 649 671 22
9 720 742 22
10 968 987 19
11 1002 1024 22
12 1037 1059 22
13 1074 1096 22
14 1103 1125 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 48.39 25.83 70.95
CcL In ants, during behavior modification 73.65 24.39 122.92
CcD In ants, recently dead 57.63 29.89 85.37

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.134164 no
SC16a CcD 0.508358 no
CcL CcD 0.409735 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3179
MNRDHDADRRRPSSSSDPASPTDGSNLPELRLELPDQGLSESLQSGDTVRRRITEGSGYGSIHSPHAASASSSRP
PLEPSLDRPQARSAASTPRPSNLAHADRLKSFTRQRKPPLPRRISSNTPHRGEIFSVDDDTHEVEADAFSRHRDL
PSGYSTRRRTQLSSAMRLPSYRAPEPEPEAESSRGGVPPTTTEEDEEDESPDQAQELPLDEHVDCDSDSDLSEAE
SFTLKDRQQAINQTHPFGIRVWKPALYKKDRSIQKTAQADIHSTPGGHVSRWLLLFNLVWTLCFGWWMAALAAVG
AVVCLLFAAAPSGREYGRILWGLAGYLFYPFGKFVRLEKDEAYLHEDAHEGRSVSEYEQWQSGDLEYGRLFFGPD
RNRSIVGRSRRSIDSEPSETESLLGRGRRGESRSAVATGRRRRLFGRGEWNIGRVIFFIFFWCLISPSLIVVSAI
CWFLVFWIPMGKVAFLLFDHLRRHPLALSFESHVSYTRAEDAPDSSILLCTYRAVGSKYWKYTVDGTNIFLINLM
AVVIFVIFDWLVLERTLHLDNHITSPAFLFAASLLSIIPLAYFIGQAVASISAQSSMGLGAAVNAFFATVVEVFL
YCVALGQGKGQLVEGSIIGSIFAGVLFLPGISMCFGAIKRKTQRFNAKSAGVTSTMLLFAAVGAFSPTLFYQIHG
THELNCLDCEDWNPGGPDNPKRTHDCRRCFFSQLPALDNRFYLEAVRPYCYLAAAMLFLSYLIGLWFTLRTHAAV
IWNAEVEEKRHEEHLQASVLKSVQLPSAAETTSADIRDSQLYKRILGQSLRQAGLNSGPDDSHRRASAVSQETTQ
TQPLPPPPANGSAATPHVVPPRSHEAGRPAVQVPGLSAAQNTALAREVAEIAATAATIASRERFTRRLTAVPSGS
TAASRSHAPAPRAGTVHEVGAEEATATAAAAAAVAAAATGVATAETAAAQGAGHGGHDAPNWGRTKSSVILLGAT
VLYAIIAEILVDTVDVVLESFSIDQKFLGITLFALVPNTTEFLNAISFAMNGNIALSMEIGSAYALQVCLLQIPC
LVLFSALYPSAAQGEDATMYTFSLLFPQWDMVTVILCVFLLSNVYGEGKSNYFKGSILLLTYLVVITGYFFSGYT
SDVMGSARMDVMAADGRWQKFKTVGGMGRGEVFAV
Coding >Ophio5|3179
ATGAATCGAGACCACGACGCCGACCGTCGCCGACCGTCGTCATCTTCGGATCCGGCCTCGCCCACCGATGGCAGC
AATTTGCCTGAGCTGAGGCTGGAGCTCCCCGACCAAGGCTTGTCCGAGAGTCTACAGTCGGGCGACACTGTGCGG
CGTCGCATCACCGAAGGCAGCGGATATGGTTCCATCCACTCGCCTCATGCCGCTTCGGCCAGCTCCAGTCGCCCC
CCGCTAGAACCGTCGCTGGATCGTCCACAGGCCAGGAGCGCTGCCTCGACGCCGCGCCCAAGCAACCTCGCCCAC
GCCGATCGTCTCAAGTCCTTCACTCGCCAGCGAAAGCCGCCTTTGCCGCGTCGCATTTCATCCAACACGCCTCAC
CGGGGCGAAATCTTCTCCGTCGACGACGATACCCACGAGGTCGAGGCCGATGCCTTCAGTCGCCATCGCGATCTG
CCCTCAGGCTATAGTACTCGTCGCCGAACCCAGCTCTCGTCGGCCATGCGTCTGCCGTCGTACCGTGCCCCCGAG
CCCGAGCCCGAAGCCGAGTCTTCCCGCGGCGGCGTTCCGCCCACGACGACGGAGGAGGACGAGGAAGATGAGAGC
CCCGATCAGGCTCAGGAGCTGCCGCTGGACGAACATGTCGACTGCGACTCGGATAGCGACCTGAGCGAGGCCGAG
AGCTTCACCCTCAAGGACCGCCAGCAGGCCATCAACCAGACGCATCCATTCGGCATCCGCGTCTGGAAGCCCGCC
CTCTATAAAAAGGATCGTTCGATTCAGAAGACGGCTCAAGCCGATATCCACTCCACCCCCGGTGGCCACGTCAGT
CGCTGGCTACTCCTCTTCAATCTCGTCTGGACCCTGTGCTTCGGCTGGTGGATGGCCGCCCTGGCCGCCGTTGGC
GCCGTCGTCTGCCTCCTCTTCGCCGCCGCCCCGAGCGGTCGGGAGTACGGTCGCATCCTCTGGGGCCTGGCCGGC
TACCTCTTCTATCCATTTGGCAAGTTTGTGCGGCTGGAAAAGGACGAGGCCTACCTTCACGAGGACGCGCACGAG
GGCCGGAGCGTCTCCGAGTACGAGCAGTGGCAAAGCGGCGACCTCGAGTACGGCCGGCTCTTCTTTGGGCCCGAT
CGCAACCGGTCCATCGTCGGCCGCTCCCGCCGGAGCATCGACTCGGAGCCGAGCGAGACGGAGAGCCTGCTGGGC
CGCGGCCGTCGCGGTGAGTCTCGCTCGGCCGTCGCCACGGGCCGGCGCCGGAGGCTCTTTGGCCGCGGCGAGTGG
AACATTGGCCGCGTCATCTTCTTCATCTTCTTCTGGTGCCTCATCTCGCCCTCGCTCATTGTCGTCTCTGCTATT
TGCTGGTTCCTTGTCTTCTGGATCCCCATGGGCAAGGTCGCCTTTCTCCTCTTCGACCACCTGCGGCGCCACCCG
CTGGCTCTGTCATTTGAGTCGCACGTTAGCTACACGCGCGCCGAGGATGCGCCCGACTCTTCCATCCTCCTCTGC
ACCTATCGCGCTGTCGGCTCCAAGTACTGGAAGTACACGGTCGACGGCACCAACATCTTCCTCATCAACCTCATG
GCCGTTGTCATCTTCGTCATCTTCGACTGGCTCGTCTTGGAACGCACTTTACACCTGGACAACCACATTACGTCG
CCGGCCTTTCTCTTTGCCGCCTCGCTGCTGTCCATCATCCCGCTGGCTTATTTCATTGGCCAGGCCGTGGCATCC
ATTTCGGCGCAATCGTCGATGGGTCTGGGCGCCGCCGTCAACGCCTTCTTTGCCACCGTCGTCGAGGTCTTTCTC
TACTGCGTCGCCCTTGGTCAGGGCAAGGGCCAGCTCGTTGAGGGGAGCATCATCGGCAGCATCTTCGCCGGCGTT
CTCTTCCTGCCGGGCATCTCCATGTGCTTTGGTGCCATTAAGCGCAAGACGCAGCGCTTCAACGCCAAGTCGGCC
GGCGTCACGTCGACCATGCTGCTGTTCGCCGCCGTCGGCGCCTTTAGCCCGACGCTCTTCTACCAGATTCACGGC
ACCCACGAGCTGAACTGCCTCGACTGCGAGGACTGGAACCCGGGCGGCCCCGACAACCCGAAGCGGACGCACGAC
TGCCGGCGTTGCTTTTTTTCCCAGCTGCCGGCGCTGGACAACCGCTTCTACCTCGAGGCCGTACGGCCCTACTGC
TACCTGGCCGCCGCCATGCTGTTCCTGTCGTACCTGATTGGGCTGTGGTTCACGCTGCGGACGCACGCGGCCGTC
ATCTGGAACGCCGAGGTGGAGGAAAAGAGGCACGAGGAGCACCTGCAGGCGTCTGTGCTTAAGAGTGTACAGCTG
CCGTCGGCTGCCGAGACGACGAGTGCCGACATCCGCGACTCACAGCTCTACAAGCGCATACTCGGACAGTCGCTG
AGGCAGGCCGGTCTGAATTCCGGGCCGGACGACTCGCACCGGCGGGCCTCGGCTGTGTCCCAAGAAACTACCCAG
ACGCAGCCACTACCGCCCCCGCCGGCTAACGGCTCGGCCGCGACGCCGCACGTGGTGCCTCCCCGGAGTCACGAA
GCGGGACGGCCGGCGGTGCAGGTCCCGGGTCTCAGCGCGGCGCAGAACACGGCATTGGCACGGGAGGTGGCGGAG
ATTGCGGCCACGGCGGCGACAATAGCCTCGCGCGAGCGGTTCACGCGCAGGTTAACGGCGGTGCCCAGCGGATCG
ACGGCGGCGTCACGCAGCCACGCGCCGGCGCCTCGGGCCGGAACCGTGCACGAAGTCGGGGCCGAGGAGGCTACT
GCAACTGCTGCTGCTGCGGCGGCGGTGGCGGCGGCGGCAACAGGTGTGGCGACTGCGGAAACGGCGGCGGCGCAA
GGTGCAGGCCACGGCGGTCACGACGCGCCCAACTGGGGACGGACCAAGAGCTCCGTTATCCTCCTCGGGGCCACT
GTGCTGTACGCCATCATCGCCGAGATCCTGGTGGATACGGTGGACGTGGTTTTGGAGAGCTTCTCGATCGACCAG
AAGTTTCTCGGCATCACACTCTTTGCCTTGGTTCCCAACACGACGGAGTTTCTGAACGCCATCTCGTTCGCCATG
AACGGCAACATTGCGCTCTCGATGGAGATTGGCTCGGCCTACGCGCTTCAGGTGTGCCTGTTACAGATACCCTGC
CTTGTGCTCTTCTCTGCTCTGTACCCGAGCGCGGCACAGGGCGAGGACGCGACCATGTACACGTTTTCGCTGCTT
TTCCCGCAGTGGGATATGGTTACGGTCATCCTCTGCGTCTTCCTGCTGAGCAACGTGTACGGCGAGGGGAAGAGC
AACTACTTCAAGGGCAGCATCCTGCTGTTGACGTATCTGGTCGTCATCACCGGCTACTTCTTCAGCGGCTACACG
TCGGACGTGATGGGCTCGGCGAGGATGGACGTGATGGCGGCGGATGGGCGGTGGCAGAAGTTTAAAACGGTTGGG
GGCATGGGCAGGGGAGAGGTCTTCGCGGTG
Transcript >Ophio5|3179
ATGAATCGAGACCACGACGCCGACCGTCGCCGACCGTCGTCATCTTCGGATCCGGCCTCGCCCACCGATGGCAGC
AATTTGCCTGAGCTGAGGCTGGAGCTCCCCGACCAAGGCTTGTCCGAGAGTCTACAGTCGGGCGACACTGTGCGG
CGTCGCATCACCGAAGGCAGCGGATATGGTTCCATCCACTCGCCTCATGCCGCTTCGGCCAGCTCCAGTCGCCCC
CCGCTAGAACCGTCGCTGGATCGTCCACAGGCCAGGAGCGCTGCCTCGACGCCGCGCCCAAGCAACCTCGCCCAC
GCCGATCGTCTCAAGTCCTTCACTCGCCAGCGAAAGCCGCCTTTGCCGCGTCGCATTTCATCCAACACGCCTCAC
CGGGGCGAAATCTTCTCCGTCGACGACGATACCCACGAGGTCGAGGCCGATGCCTTCAGTCGCCATCGCGATCTG
CCCTCAGGCTATAGTACTCGTCGCCGAACCCAGCTCTCGTCGGCCATGCGTCTGCCGTCGTACCGTGCCCCCGAG
CCCGAGCCCGAAGCCGAGTCTTCCCGCGGCGGCGTTCCGCCCACGACGACGGAGGAGGACGAGGAAGATGAGAGC
CCCGATCAGGCTCAGGAGCTGCCGCTGGACGAACATGTCGACTGCGACTCGGATAGCGACCTGAGCGAGGCCGAG
AGCTTCACCCTCAAGGACCGCCAGCAGGCCATCAACCAGACGCATCCATTCGGCATCCGCGTCTGGAAGCCCGCC
CTCTATAAAAAGGATCGTTCGATTCAGAAGACGGCTCAAGCCGATATCCACTCCACCCCCGGTGGCCACGTCAGT
CGCTGGCTACTCCTCTTCAATCTCGTCTGGACCCTGTGCTTCGGCTGGTGGATGGCCGCCCTGGCCGCCGTTGGC
GCCGTCGTCTGCCTCCTCTTCGCCGCCGCCCCGAGCGGTCGGGAGTACGGTCGCATCCTCTGGGGCCTGGCCGGC
TACCTCTTCTATCCATTTGGCAAGTTTGTGCGGCTGGAAAAGGACGAGGCCTACCTTCACGAGGACGCGCACGAG
GGCCGGAGCGTCTCCGAGTACGAGCAGTGGCAAAGCGGCGACCTCGAGTACGGCCGGCTCTTCTTTGGGCCCGAT
CGCAACCGGTCCATCGTCGGCCGCTCCCGCCGGAGCATCGACTCGGAGCCGAGCGAGACGGAGAGCCTGCTGGGC
CGCGGCCGTCGCGGTGAGTCTCGCTCGGCCGTCGCCACGGGCCGGCGCCGGAGGCTCTTTGGCCGCGGCGAGTGG
AACATTGGCCGCGTCATCTTCTTCATCTTCTTCTGGTGCCTCATCTCGCCCTCGCTCATTGTCGTCTCTGCTATT
TGCTGGTTCCTTGTCTTCTGGATCCCCATGGGCAAGGTCGCCTTTCTCCTCTTCGACCACCTGCGGCGCCACCCG
CTGGCTCTGTCATTTGAGTCGCACGTTAGCTACACGCGCGCCGAGGATGCGCCCGACTCTTCCATCCTCCTCTGC
ACCTATCGCGCTGTCGGCTCCAAGTACTGGAAGTACACGGTCGACGGCACCAACATCTTCCTCATCAACCTCATG
GCCGTTGTCATCTTCGTCATCTTCGACTGGCTCGTCTTGGAACGCACTTTACACCTGGACAACCACATTACGTCG
CCGGCCTTTCTCTTTGCCGCCTCGCTGCTGTCCATCATCCCGCTGGCTTATTTCATTGGCCAGGCCGTGGCATCC
ATTTCGGCGCAATCGTCGATGGGTCTGGGCGCCGCCGTCAACGCCTTCTTTGCCACCGTCGTCGAGGTCTTTCTC
TACTGCGTCGCCCTTGGTCAGGGCAAGGGCCAGCTCGTTGAGGGGAGCATCATCGGCAGCATCTTCGCCGGCGTT
CTCTTCCTGCCGGGCATCTCCATGTGCTTTGGTGCCATTAAGCGCAAGACGCAGCGCTTCAACGCCAAGTCGGCC
GGCGTCACGTCGACCATGCTGCTGTTCGCCGCCGTCGGCGCCTTTAGCCCGACGCTCTTCTACCAGATTCACGGC
ACCCACGAGCTGAACTGCCTCGACTGCGAGGACTGGAACCCGGGCGGCCCCGACAACCCGAAGCGGACGCACGAC
TGCCGGCGTTGCTTTTTTTCCCAGCTGCCGGCGCTGGACAACCGCTTCTACCTCGAGGCCGTACGGCCCTACTGC
TACCTGGCCGCCGCCATGCTGTTCCTGTCGTACCTGATTGGGCTGTGGTTCACGCTGCGGACGCACGCGGCCGTC
ATCTGGAACGCCGAGGTGGAGGAAAAGAGGCACGAGGAGCACCTGCAGGCGTCTGTGCTTAAGAGTGTACAGCTG
CCGTCGGCTGCCGAGACGACGAGTGCCGACATCCGCGACTCACAGCTCTACAAGCGCATACTCGGACAGTCGCTG
AGGCAGGCCGGTCTGAATTCCGGGCCGGACGACTCGCACCGGCGGGCCTCGGCTGTGTCCCAAGAAACTACCCAG
ACGCAGCCACTACCGCCCCCGCCGGCTAACGGCTCGGCCGCGACGCCGCACGTGGTGCCTCCCCGGAGTCACGAA
GCGGGACGGCCGGCGGTGCAGGTCCCGGGTCTCAGCGCGGCGCAGAACACGGCATTGGCACGGGAGGTGGCGGAG
ATTGCGGCCACGGCGGCGACAATAGCCTCGCGCGAGCGGTTCACGCGCAGGTTAACGGCGGTGCCCAGCGGATCG
ACGGCGGCGTCACGCAGCCACGCGCCGGCGCCTCGGGCCGGAACCGTGCACGAAGTCGGGGCCGAGGAGGCTACT
GCAACTGCTGCTGCTGCGGCGGCGGTGGCGGCGGCGGCAACAGGTGTGGCGACTGCGGAAACGGCGGCGGCGCAA
GGTGCAGGCCACGGCGGTCACGACGCGCCCAACTGGGGACGGACCAAGAGCTCCGTTATCCTCCTCGGGGCCACT
GTGCTGTACGCCATCATCGCCGAGATCCTGGTGGATACGGTGGACGTGGTTTTGGAGAGCTTCTCGATCGACCAG
AAGTTTCTCGGCATCACACTCTTTGCCTTGGTTCCCAACACGACGGAGTTTCTGAACGCCATCTCGTTCGCCATG
AACGGCAACATTGCGCTCTCGATGGAGATTGGCTCGGCCTACGCGCTTCAGGTGTGCCTGTTACAGATACCCTGC
CTTGTGCTCTTCTCTGCTCTGTACCCGAGCGCGGCACAGGGCGAGGACGCGACCATGTACACGTTTTCGCTGCTT
TTCCCGCAGTGGGATATGGTTACGGTCATCCTCTGCGTCTTCCTGCTGAGCAACGTGTACGGCGAGGGGAAGAGC
AACTACTTCAAGGGCAGCATCCTGCTGTTGACGTATCTGGTCGTCATCACCGGCTACTTCTTCAGCGGCTACACG
TCGGACGTGATGGGCTCGGCGAGGATGGACGTGATGGCGGCGGATGGGCGGTGGCAGAAGTTTAAAACGGTTGGG
GGCATGGGCAGGGGAGAGGTCTTCGCGGTGTGA
Gene >Ophio5|3179
ATGAATCGAGACCACGACGCCGACCGTCGCCGACCGTCGTCATCTTCGGATCCGGCCTCGCCCACCGATGGCAGC
AATTTGCCTGAGCTGAGGCTGGAGCTCCCCGACCAAGGCTTGTCCGAGAGTCTACAGTCGGGCGACACTGTGCGG
CGTCGCATCACCGAAGGCAGCGGATATGGTCAGTGTGTCGATGCTGGGGGAGTAGGATGACAACGCGCTGACGAT
GGCCTCAGGTTCCATCCACTCGCCTCATGCCGCTTCGGCCAGCTCCAGTCGCCCCCCGCTAGAACCGTCGCTGGA
TCGTCCACAGGCCAGGAGCGCTGCCTCGACGCCGCGCCCAAGCAACCTCGCCCACGCCGATCGTCTCAAGTCCTT
CACTCGCCAGCGAAAGCCGCCTTTGCCGCGTCGCATTTCATCCAACACGCCTCACCGGGGCGAAATCTTCTCCGT
CGACGACGATACCCACGAGGTCGAGGCCGATGCCTTCAGTCGCCATCGCGATCTGCCCTCAGGCTATAGTACTCG
TCGCCGAACCCAGCTCTCGTCGGCCATGCGTCTGCCGTCGTACCGTGCCCCCGAGCCCGAGCCCGAAGCCGAGTC
TTCCCGCGGCGGCGTTCCGCCCACGACGACGGAGGAGGACGAGGAAGATGAGAGCCCCGATCAGGCTCAGGAGCT
GCCGCTGGACGAACATGTCGACTGCGACTCGGATAGCGACCTGAGCGAGGCCGAGAGCTTCACCCTCAAGGACCG
CCAGCAGGCCATCAACCAGACGCATCCATTCGGCATCCGCGTCTGGAAGCCCGCCCTCTATAAAAAGGATCGTTC
GATTCAGAAGACGGCTCAAGCCGATATCCACTCCACCCCCGGTGGCCACGTCAGTCGCTGGCTACTCCTCTTCAA
TCTCGTCTGGACCCTGTGCTTCGGCTGGTGGATGGCCGCCCTGGCCGCCGTTGGCGCCGTCGTCTGCCTCCTCTT
CGCCGCCGCCCCGAGCGGTCGGGAGTACGGTCGCATCCTCTGGGGCCTGGCCGGCTACCTCTTCTATCCATTTGG
CAAGTTTGTGCGGCTGGAAAAGGACGAGGCCTACCTTCACGAGGACGCGCACGAGGGCCGGAGCGTCTCCGAGTA
CGAGCAGTGGCAAAGCGGCGACCTCGAGTACGGCCGGCTCTTCTTTGGGCCCGATCGCAACCGGTCCATCGTCGG
CCGCTCCCGCCGGAGCATCGACTCGGAGCCGAGCGAGACGGAGAGCCTGCTGGGCCGCGGCCGTCGCGGTGAGTC
TCGCTCGGCCGTCGCCACGGGCCGGCGCCGGAGGCTCTTTGGCCGCGGCGAGTGGAACATTGGCCGCGTCATCTT
CTTCATCTTCTTCTGGTGCCTCATCTCGCCCTCGCTCATTGTCGTCTCTGCTATTTGCTGGTTCCTTGTCTTCTG
GATCCCCATGGGCAAGGTCGCCTTTCTCCTCTTCGACCACCTGCGGCGCCACCCGCTGGCTCTGTCATTTGAGTC
GCACGTTAGCTACACGCGCGCCGAGGATGCGCCCGACTCTTCCATCCTCCTCTGCACCTATCGCGCTGTCGGCTC
CAAGTACTGGAAGTACACGGTCGACGGCACCAACATCTTCCTCATCAACCTCATGGCCGTTGTCATCTTCGTCAT
CTTCGACTGGCTCGTCTTGGAACGCACTTTACACCTGGACAACCACATTACGTCGCCGGCCTTTCTCTTTGCCGC
CTCGCTGCTGTCCATCATCCCGCTGGCTTATTTCATTGGCCAGGCCGTGGCATCCATTTCGGCGCAATCGTCGAT
GGGTCTGGGCGCCGCCGTCAACGCCTTCTTTGCCACCGTCGTCGAGGTCTTTCTCTACTGCGTCGCCCTTGGTCA
GGGCAAGGGCCAGCTCGTTGAGGGGAGCATCATCGGCAGCATCTTCGCCGGCGTTCTCTTCCTGCCGGGCATCTC
CATGTGCTTTGGTGCCATTAAGCGCAAGACGCAGCGCTTCAACGCCAAGTCGGCCGGCGTCACGTCGACCATGCT
GCTGTTCGCCGCCGTCGGCGCCTTTAGCCCGACGCTCTTCTACCAGATTCACGGCACCCACGAGCTGAACTGCCT
CGACTGCGAGGACTGGAACCCGGGCGGCCCCGACAACCCGAAGCGGACGCACGACTGCCGGCGTTGCTTTTTTTC
CCAGCTGCCGGCGCTGGACAACCGCTTCTACCTCGAGGCCGTACGGCCCTACTGCTACCTGGCCGCCGCCATGCT
GTTCCTGTCGTACCTGATTGGGCTGTGGTTCACGCTGCGGACGCACGCGGCCGTCATCTGGAACGCCGAGGTGGA
GGAAAAGAGGCACGAGGAGCACCTGCAGGCGTCTGTGCTTAAGAGTGTACAGCTGCCGTCGGCTGCCGAGACGAC
GAGTGCCGACATCCGCGACTCACAGCTCTACAAGCGCATACTCGGACAGTCGCTGAGGCAGGCCGGTCTGAATTC
CGGGCCGGACGACTCGCACCGGCGGGCCTCGGCTGTGTCCCAAGAAACTACCCAGACGCAGCCACTACCGCCCCC
GCCGGCTAACGGCTCGGCCGCGACGCCGCACGTGGTGCCTCCCCGGAGTCACGAAGCGGGACGGCCGGCGGTGCA
GGTCCCGGGTCTCAGCGCGGCGCAGAACACGGCATTGGCACGGGAGGTGGCGGAGATTGCGGCCACGGCGGCGAC
AATAGCCTCGCGCGAGCGGTTCACGCGCAGGTTAACGGCGGTGCCCAGCGGATCGACGGCGGCGTCACGCAGCCA
CGCGCCGGCGCCTCGGGCCGGAACCGTGCACGAAGTCGGGGCCGAGGAGGCTACTGCAACTGCTGCTGCTGCGGC
GGCGGTGGCGGCGGCGGCAACAGGTGTGGCGACTGCGGAAACGGCGGCGGCGCAAGGTGCAGGCCACGGCGGTCA
CGACGCGCCCAACTGGGGACGGACCAAGAGCTCCGTTATCCTCCTCGGGGCCACTGTGCTGTACGCCATCATCGC
CGAGATCCTGGTGGATACGGTGGACGTGGTTTTGGAGAGCTTCTCGATCGACCAGAAGTTTCTCGGCATCACACT
CTTTGCCTTGGTTCCCAACACGACGGAGTTTCTGGTAAGTAGCTCGGCAGCAGAGGAGTCGAAACTTAGGCTGAT
GGTTTTTTTTTTCAGAACGCCATCTCGTTCGCCATGAACGGCAACATTGCGCTCTCGATGGAGATTGGCTCGGCC
TACGCGCTTCAGGTGTGCCTGTTACAGATACCCTGCCTTGTGCTCTTCTCTGCTCTGTACCCGAGCGCGGCACAG
GGCGAGGACGCGACCATGTACACGTTTTCGCTGCTTTTCCCGCAGTGGGATATGGTTACGGTCATCCTCTGCGTC
TTCCTGCTGAGCAACGTGTACGGCGAGGGGAAGAGCAACTACTTCAAGGGCAGCATCCTGCTGTTGACGTATCTG
GTCGTCATCACCGGCTACTTCTTCAGCGGCTACACGTCGGACGTGATGGGCTCGGCGAGGATGGACGTGATGGCG
GCGGATGGGCGGTGGCAGAAGTTTAAAACGGTTGGGGGCATGGGCAGGGGAGAGGTCTTCGCGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail