Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3173
Gene name
Locationscaffold_250:19542..21099
Strand+
Gene length (bp)1557
Transcript length (bp)1557
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22105|TENX_HUMAN Tenascin-X OS=Homo sapiens GN=TNXB PE=1 SV=4 36 481 1.0E-18
sp|P22105|TENX_HUMAN Tenascin-X OS=Homo sapiens GN=TNXB PE=1 SV=4 63 516 2.0E-17
sp|P22105|TENX_HUMAN Tenascin-X OS=Homo sapiens GN=TNXB PE=1 SV=4 56 514 2.0E-15
sp|Q9VYN8|TENA_DROME Teneurin-a OS=Drosophila melanogaster GN=Ten-a PE=1 SV=2 74 384 2.0E-13
sp|Q9W7R4|TEN3_DANRE Teneurin-3 OS=Danio rerio GN=tenm3 PE=2 SV=1 57 384 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22105|TENX_HUMAN Tenascin-X OS=Homo sapiens GN=TNXB PE=1 SV=4 36 481 1.0E-18
sp|P22105|TENX_HUMAN Tenascin-X OS=Homo sapiens GN=TNXB PE=1 SV=4 63 516 2.0E-17
sp|P22105|TENX_HUMAN Tenascin-X OS=Homo sapiens GN=TNXB PE=1 SV=4 56 514 2.0E-15
sp|Q9VYN8|TENA_DROME Teneurin-a OS=Drosophila melanogaster GN=Ten-a PE=1 SV=2 74 384 2.0E-13
sp|Q9W7R4|TEN3_DANRE Teneurin-3 OS=Danio rerio GN=tenm3 PE=2 SV=1 57 384 4.0E-13
sp|Q9WTS4|TEN1_MOUSE Teneurin-1 OS=Mus musculus GN=Tenm1 PE=1 SV=1 63 502 6.0E-13
sp|Q9W6V6|TEN1_CHICK Teneurin-1 OS=Gallus gallus GN=TENM1 PE=1 SV=1 63 402 1.0E-12
sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=TENM1 PE=1 SV=2 63 502 2.0E-12
sp|O88281|MEGF6_RAT Multiple epidermal growth factor-like domains protein 6 OS=Rattus norvegicus GN=Megf6 PE=1 SV=1 47 517 1.0E-10
sp|Q9VYN8|TENA_DROME Teneurin-a OS=Drosophila melanogaster GN=Ten-a PE=1 SV=2 250 512 3.0E-10
sp|Q9VYN8|TENA_DROME Teneurin-a OS=Drosophila melanogaster GN=Ten-a PE=1 SV=2 24 340 1.0E-09
sp|O75095|MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens GN=MEGF6 PE=1 SV=4 47 513 4.0E-09
sp|O88281|MEGF6_RAT Multiple epidermal growth factor-like domains protein 6 OS=Rattus norvegicus GN=Megf6 PE=1 SV=1 57 512 6.0E-09
sp|Q9VYN8|TENA_DROME Teneurin-a OS=Drosophila melanogaster GN=Ten-a PE=1 SV=2 162 434 3.0E-08
sp|G5EGQ6|TEN1_CAEEL Teneurin-1 OS=Caenorhabditis elegans GN=ten-1 PE=1 SV=1 76 377 3.0E-08
sp|Q9W6V6|TEN1_CHICK Teneurin-1 OS=Gallus gallus GN=TENM1 PE=1 SV=1 36 301 3.0E-07
sp|Q9W7R3|TEN4_DANRE Teneurin-4 OS=Danio rerio GN=tenm4 PE=2 SV=1 76 384 3.0E-07
sp|Q80T91|MEG11_MOUSE Multiple epidermal growth factor-like domains protein 11 OS=Mus musculus GN=Megf11 PE=1 SV=3 46 436 6.0E-07
sp|Q80V70|MEGF6_MOUSE Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus GN=Megf6 PE=2 SV=3 49 518 9.0E-07
sp|O88281|MEGF6_RAT Multiple epidermal growth factor-like domains protein 6 OS=Rattus norvegicus GN=Megf6 PE=1 SV=1 47 496 2.0E-06
sp|Q03376|BAR3_CHITE Balbiani ring protein 3 OS=Chironomus tentans GN=BR3 PE=2 SV=1 65 502 2.0E-06
sp|Q03376|BAR3_CHITE Balbiani ring protein 3 OS=Chironomus tentans GN=BR3 PE=2 SV=1 52 516 2.0E-06
sp|Q6DIB5|MEG10_MOUSE Multiple epidermal growth factor-like domains protein 10 OS=Mus musculus GN=Megf10 PE=1 SV=1 60 512 2.0E-06
sp|Q3UHK6|TEN4_MOUSE Teneurin-4 OS=Mus musculus GN=Tenm4 PE=1 SV=2 101 384 5.0E-06
sp|Q6N022|TEN4_HUMAN Teneurin-4 OS=Homo sapiens GN=TENM4 PE=1 SV=2 101 384 6.0E-06
sp|Q5VY43|PEAR1_HUMAN Platelet endothelial aggregation receptor 1 OS=Homo sapiens GN=PEAR1 PE=1 SV=1 57 512 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3173
MLFKHLVLTAICSLQSVSATPVGEGQVFARTDYNNCGKDATNQYGVCVCRNGDMKYDAKTQTCSCADGKTWTGTK
CDYDCGKDALYQYGKCVCRHGDQAYDAKSKTCSCTGGKVWTGTKCEYDCGKEASYSNGKCVCNHRDQEYDSKSKT
CSCTGGKVWTGTKCEYDCGKEASYSNGKCVCNHRDQEYDSKSKTCSCTGGKVWTGTKCEYDCGKDALYQYGKCVC
RHRDQEYDSKSKTCSCTGGKVWTGTKCEYDCGKEASYSNGKCACNHKDKSYDEKSKTCSCTGGKIWNGQTCEYDC
GKEAVFEYGKCVCRHRDQHYDDKSKTCSCTGGKIWNGQKCEYDCGKEASFSNGQCVCHHKGQHYDDKAKTCACTG
GTVWNGKGCQYDCGKDASYDEKLSKCVCGKADMSYDSGSKTCACSGGKVWNGSKCESNCGPDAVFQYGKCVCRHE
GKEFNDKAKTCACAGGKSWNGSKCVYDCGKDASYDEKRAQCVCNNSAFEYDGASKTCKCAKGKCYGPY
Coding >Ophio5|3173
ATGCTCTTCAAGCACCTCGTCCTGACGGCGATTTGTTCGCTGCAGTCCGTCTCGGCCACGCCCGTGGGTGAGGGA
CAAGTGTTTGCCCGCACCGACTACAACAACTGCGGCAAGGATGCCACCAACCAGTATGGAGTTTGTGTCTGCCGC
AATGGCGATATGAAGTACGATGCCAAGACGCAGACCTGCTCGTGCGCAGACGGCAAGACGTGGACGGGCACCAAG
TGTGATTATGACTGTGGCAAGGATGCCCTCTACCAGTACGGCAAATGCGTCTGCCGCCACGGAGATCAAGCGTAT
GATGCCAAGTCGAAGACGTGCTCTTGCACCGGTGGCAAGGTCTGGACGGGAACCAAGTGTGAATACGACTGCGGC
AAGGAGGCGTCTTACAGCAACGGCAAATGCGTCTGCAACCACAGAGATCAGGAGTACGATAGCAAGTCGAAGACG
TGCTCTTGCACCGGCGGCAAGGTCTGGACGGGCACCAAGTGCGAGTACGATTGCGGCAAGGAGGCGTCTTATAGT
AACGGCAAATGCGTCTGCAACCACAGAGATCAGGAGTACGATAGCAAGTCGAAGACGTGCTCTTGCACCGGCGGC
AAGGTCTGGACGGGAACCAAGTGTGAATACGACTGCGGCAAGGATGCCCTCTACCAGTACGGCAAATGCGTCTGC
CGTCATAGAGACCAAGAATACGATAGCAAGTCTAAGACGTGCTCTTGCACTGGCGGCAAGGTCTGGACGGGCACC
AAGTGCGAGTACGACTGCGGAAAGGAGGCATCCTATAGCAACGGCAAATGTGCCTGCAACCACAAGGATAAGAGC
TACGACGAGAAATCCAAGACGTGCTCTTGCACGGGCGGAAAGATCTGGAATGGACAGACGTGTGAGTACGACTGC
GGCAAGGAAGCCGTCTTCGAATACGGCAAATGCGTCTGCCGCCACCGCGACCAGCACTACGACGACAAGTCCAAG
ACTTGCTCTTGCACCGGCGGCAAGATCTGGAATGGACAAAAGTGCGAATACGACTGCGGCAAGGAGGCCAGCTTC
TCCAACGGCCAGTGCGTCTGCCACCACAAGGGCCAGCACTACGACGACAAGGCCAAGACTTGCGCCTGCACGGGA
GGCACAGTCTGGAACGGAAAAGGTTGCCAATACGACTGCGGCAAGGACGCCTCGTACGACGAGAAGCTGTCCAAG
TGCGTCTGCGGCAAGGCTGACATGTCCTACGACTCCGGCAGCAAGACGTGTGCCTGCTCGGGCGGAAAGGTCTGG
AACGGCAGCAAGTGCGAATCCAACTGCGGTCCGGACGCCGTCTTCCAATACGGCAAATGCGTGTGCCGCCACGAG
GGCAAGGAGTTCAACGACAAGGCCAAGACTTGTGCTTGTGCGGGCGGTAAGAGCTGGAATGGATCCAAGTGTGTC
TACGACTGTGGCAAGGACGCATCGTATGATGAGAAGCGGGCCCAGTGTGTCTGCAACAACAGTGCGTTCGAGTAT
GATGGCGCGTCCAAGACGTGCAAGTGTGCCAAGGGGAAGTGCTACGGGCCATAC
Transcript >Ophio5|3173
ATGCTCTTCAAGCACCTCGTCCTGACGGCGATTTGTTCGCTGCAGTCCGTCTCGGCCACGCCCGTGGGTGAGGGA
CAAGTGTTTGCCCGCACCGACTACAACAACTGCGGCAAGGATGCCACCAACCAGTATGGAGTTTGTGTCTGCCGC
AATGGCGATATGAAGTACGATGCCAAGACGCAGACCTGCTCGTGCGCAGACGGCAAGACGTGGACGGGCACCAAG
TGTGATTATGACTGTGGCAAGGATGCCCTCTACCAGTACGGCAAATGCGTCTGCCGCCACGGAGATCAAGCGTAT
GATGCCAAGTCGAAGACGTGCTCTTGCACCGGTGGCAAGGTCTGGACGGGAACCAAGTGTGAATACGACTGCGGC
AAGGAGGCGTCTTACAGCAACGGCAAATGCGTCTGCAACCACAGAGATCAGGAGTACGATAGCAAGTCGAAGACG
TGCTCTTGCACCGGCGGCAAGGTCTGGACGGGCACCAAGTGCGAGTACGATTGCGGCAAGGAGGCGTCTTATAGT
AACGGCAAATGCGTCTGCAACCACAGAGATCAGGAGTACGATAGCAAGTCGAAGACGTGCTCTTGCACCGGCGGC
AAGGTCTGGACGGGAACCAAGTGTGAATACGACTGCGGCAAGGATGCCCTCTACCAGTACGGCAAATGCGTCTGC
CGTCATAGAGACCAAGAATACGATAGCAAGTCTAAGACGTGCTCTTGCACTGGCGGCAAGGTCTGGACGGGCACC
AAGTGCGAGTACGACTGCGGAAAGGAGGCATCCTATAGCAACGGCAAATGTGCCTGCAACCACAAGGATAAGAGC
TACGACGAGAAATCCAAGACGTGCTCTTGCACGGGCGGAAAGATCTGGAATGGACAGACGTGTGAGTACGACTGC
GGCAAGGAAGCCGTCTTCGAATACGGCAAATGCGTCTGCCGCCACCGCGACCAGCACTACGACGACAAGTCCAAG
ACTTGCTCTTGCACCGGCGGCAAGATCTGGAATGGACAAAAGTGCGAATACGACTGCGGCAAGGAGGCCAGCTTC
TCCAACGGCCAGTGCGTCTGCCACCACAAGGGCCAGCACTACGACGACAAGGCCAAGACTTGCGCCTGCACGGGA
GGCACAGTCTGGAACGGAAAAGGTTGCCAATACGACTGCGGCAAGGACGCCTCGTACGACGAGAAGCTGTCCAAG
TGCGTCTGCGGCAAGGCTGACATGTCCTACGACTCCGGCAGCAAGACGTGTGCCTGCTCGGGCGGAAAGGTCTGG
AACGGCAGCAAGTGCGAATCCAACTGCGGTCCGGACGCCGTCTTCCAATACGGCAAATGCGTGTGCCGCCACGAG
GGCAAGGAGTTCAACGACAAGGCCAAGACTTGTGCTTGTGCGGGCGGTAAGAGCTGGAATGGATCCAAGTGTGTC
TACGACTGTGGCAAGGACGCATCGTATGATGAGAAGCGGGCCCAGTGTGTCTGCAACAACAGTGCGTTCGAGTAT
GATGGCGCGTCCAAGACGTGCAAGTGTGCCAAGGGGAAGTGCTACGGGCCATACTAA
Gene >Ophio5|3173
ATGCTCTTCAAGCACCTCGTCCTGACGGCGATTTGTTCGCTGCAGTCCGTCTCGGCCACGCCCGTGGGTGAGGGA
CAAGTGTTTGCCCGCACCGACTACAACAACTGCGGCAAGGATGCCACCAACCAGTATGGAGTTTGTGTCTGCCGC
AATGGCGATATGAAGTACGATGCCAAGACGCAGACCTGCTCGTGCGCAGACGGCAAGACGTGGACGGGCACCAAG
TGTGATTATGACTGTGGCAAGGATGCCCTCTACCAGTACGGCAAATGCGTCTGCCGCCACGGAGATCAAGCGTAT
GATGCCAAGTCGAAGACGTGCTCTTGCACCGGTGGCAAGGTCTGGACGGGAACCAAGTGTGAATACGACTGCGGC
AAGGAGGCGTCTTACAGCAACGGCAAATGCGTCTGCAACCACAGAGATCAGGAGTACGATAGCAAGTCGAAGACG
TGCTCTTGCACCGGCGGCAAGGTCTGGACGGGCACCAAGTGCGAGTACGATTGCGGCAAGGAGGCGTCTTATAGT
AACGGCAAATGCGTCTGCAACCACAGAGATCAGGAGTACGATAGCAAGTCGAAGACGTGCTCTTGCACCGGCGGC
AAGGTCTGGACGGGAACCAAGTGTGAATACGACTGCGGCAAGGATGCCCTCTACCAGTACGGCAAATGCGTCTGC
CGTCATAGAGACCAAGAATACGATAGCAAGTCTAAGACGTGCTCTTGCACTGGCGGCAAGGTCTGGACGGGCACC
AAGTGCGAGTACGACTGCGGAAAGGAGGCATCCTATAGCAACGGCAAATGTGCCTGCAACCACAAGGATAAGAGC
TACGACGAGAAATCCAAGACGTGCTCTTGCACGGGCGGAAAGATCTGGAATGGACAGACGTGTGAGTACGACTGC
GGCAAGGAAGCCGTCTTCGAATACGGCAAATGCGTCTGCCGCCACCGCGACCAGCACTACGACGACAAGTCCAAG
ACTTGCTCTTGCACCGGCGGCAAGATCTGGAATGGACAAAAGTGCGAATACGACTGCGGCAAGGAGGCCAGCTTC
TCCAACGGCCAGTGCGTCTGCCACCACAAGGGCCAGCACTACGACGACAAGGCCAAGACTTGCGCCTGCACGGGA
GGCACAGTCTGGAACGGAAAAGGTTGCCAATACGACTGCGGCAAGGACGCCTCGTACGACGAGAAGCTGTCCAAG
TGCGTCTGCGGCAAGGCTGACATGTCCTACGACTCCGGCAGCAAGACGTGTGCCTGCTCGGGCGGAAAGGTCTGG
AACGGCAGCAAGTGCGAATCCAACTGCGGTCCGGACGCCGTCTTCCAATACGGCAAATGCGTGTGCCGCCACGAG
GGCAAGGAGTTCAACGACAAGGCCAAGACTTGTGCTTGTGCGGGCGGTAAGAGCTGGAATGGATCCAAGTGTGTC
TACGACTGTGGCAAGGACGCATCGTATGATGAGAAGCGGGCCCAGTGTGTCTGCAACAACAGTGCGTTCGAGTAT
GATGGCGCGTCCAAGACGTGCAAGTGTGCCAAGGGGAAGTGCTACGGGCCATACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail