Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3158
Gene name
Locationscaffold_25:60992..63711
Strand+
Gene length (bp)2719
Transcript length (bp)2322
Coding sequence length (bp)2319
Protein length (aa) 773

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) 5.3E-31 431 656
PF03129 HGTP_anticodon Anticodon binding domain 3.1E-18 669 761
PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain 1.8E-12 284 331
PF02824 TGS TGS domain 8.2E-09 114 172

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87144|SYTC_SCHPO Threonine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ths1 PE=3 SV=1 68 751 0.0E+00
sp|P04801|SYTC_YEAST Threonine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THS1 PE=1 SV=2 45 771 0.0E+00
sp|Q9D0R2|SYTC_MOUSE Threonine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Tars PE=1 SV=2 79 767 0.0E+00
sp|Q5XHY5|SYTC_RAT Threonine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Tars PE=1 SV=1 66 767 0.0E+00
sp|Q3ZBV8|SYTC_BOVIN Threonine--tRNA ligase, cytoplasmic OS=Bos taurus GN=TARS PE=2 SV=1 58 767 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87144|SYTC_SCHPO Threonine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ths1 PE=3 SV=1 68 751 0.0E+00
sp|P04801|SYTC_YEAST Threonine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THS1 PE=1 SV=2 45 771 0.0E+00
sp|Q9D0R2|SYTC_MOUSE Threonine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Tars PE=1 SV=2 79 767 0.0E+00
sp|Q5XHY5|SYTC_RAT Threonine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Tars PE=1 SV=1 66 767 0.0E+00
sp|Q3ZBV8|SYTC_BOVIN Threonine--tRNA ligase, cytoplasmic OS=Bos taurus GN=TARS PE=2 SV=1 58 767 0.0E+00
sp|P26639|SYTC_HUMAN Threonine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=TARS PE=1 SV=3 73 767 0.0E+00
sp|Q0V9S0|SYTC2_XENTR Probable threonine--tRNA ligase 2, cytoplasmic OS=Xenopus tropicalis GN=tarsl2 PE=2 SV=1 62 772 0.0E+00
sp|Q8BLY2|SYTC2_MOUSE Probable threonine--tRNA ligase 2, cytoplasmic OS=Mus musculus GN=Tarsl2 PE=1 SV=1 60 769 0.0E+00
sp|P52709|SYTC_CAEEL Threonine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=trs-1 PE=3 SV=1 69 741 0.0E+00
sp|A2RTX5|SYTC2_HUMAN Probable threonine--tRNA ligase 2, cytoplasmic OS=Homo sapiens GN=TARSL2 PE=1 SV=1 47 769 0.0E+00
sp|Q54J66|SYTC1_DICDI Probable threonine--tRNA ligase 1, cytoplasmic OS=Dictyostelium discoideum GN=thrS1 PE=3 SV=1 78 741 0.0E+00
sp|O04630|SYTM1_ARATH Threonine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana GN=THRRS PE=2 SV=3 57 743 0.0E+00
sp|A6QNM8|SYTC2_BOVIN Probable threonine--tRNA ligase 2, cytoplasmic OS=Bos taurus GN=TARSL2 PE=2 SV=1 64 683 0.0E+00
sp|Q68FW7|SYTM_RAT Threonine--tRNA ligase, mitochondrial OS=Rattus norvegicus GN=Tars2 PE=2 SV=1 80 767 0.0E+00
sp|Q3UQ84|SYTM_MOUSE Threonine--tRNA ligase, mitochondrial OS=Mus musculus GN=Tars2 PE=1 SV=1 81 767 0.0E+00
sp|Q9BW92|SYTM_HUMAN Threonine--tRNA ligase, mitochondrial OS=Homo sapiens GN=TARS2 PE=1 SV=1 82 767 0.0E+00
sp|Q8SRH2|SYTC_ENCCU Probable threonine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_1570 PE=3 SV=1 130 737 0.0E+00
sp|B7XIA1|SYTC_ENTBH Probable threonine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22768 PE=3 SV=1 130 751 7.0E-176
sp|Q9WZJ9|SYT_THEMA Threonine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=thrS PE=3 SV=1 112 739 6.0E-172
sp|A5IJ45|SYT_THEP1 Threonine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=thrS PE=3 SV=1 112 739 3.0E-171
sp|B1L7W6|SYT_THESQ Threonine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=thrS PE=3 SV=1 112 745 2.0E-169
sp|A9A078|SYT_DESOH Threonine--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=thrS PE=3 SV=1 113 748 2.0E-168
sp|Q8MP20|SYTC2_DICDI Probable threonine--tRNA ligase 2, cytoplasmic OS=Dictyostelium discoideum GN=thrS2 PE=3 SV=1 131 740 6.0E-168
sp|P18256|SYT2_BACSU Threonine--tRNA ligase 2 OS=Bacillus subtilis (strain 168) GN=thrZ PE=2 SV=2 113 754 6.0E-167
sp|B9KAN7|SYT_THENN Threonine--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=thrS PE=3 SV=1 112 770 4.0E-166
sp|C0QAP1|SYT_DESAH Threonine--tRNA ligase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=thrS PE=3 SV=1 113 740 5.0E-166
sp|Q3ABS6|SYT_CARHZ Threonine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=thrS PE=3 SV=1 113 739 1.0E-164
sp|B0S169|SYT_FINM2 Threonine--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=thrS PE=3 SV=1 129 740 8.0E-164
sp|Q8RFS6|SYT_FUSNN Threonine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=thrS PE=3 SV=1 135 737 3.0E-162
sp|A3DET1|SYT_CLOTH Threonine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=thrS PE=3 SV=1 131 754 2.0E-161
sp|Q4UKU3|SYT_RICFE Threonine--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=thrS PE=3 SV=1 113 753 1.0E-160
sp|A8GML4|SYT_RICAH Threonine--tRNA ligase OS=Rickettsia akari (strain Hartford) GN=thrS PE=3 SV=1 113 737 2.0E-159
sp|Q0AM08|SYT_MARMM Threonine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=thrS PE=3 SV=1 113 760 2.0E-159
sp|B8FN26|SYT_DESAA Threonine--tRNA ligase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=thrS PE=3 SV=1 113 761 4.0E-159
sp|C4K0X3|SYT_RICPU Threonine--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=thrS PE=3 SV=1 113 737 1.0E-157
sp|A1WU53|SYT_HALHL Threonine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=thrS PE=3 SV=1 114 740 3.0E-157
sp|Q92IX4|SYT_RICCN Threonine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=thrS PE=3 SV=1 113 737 4.0E-157
sp|C3PMR6|SYT_RICAE Threonine--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=thrS PE=3 SV=1 113 737 4.0E-157
sp|A4J4Y7|SYT_DESRM Threonine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=thrS PE=3 SV=1 130 739 4.0E-157
sp|Q2RNL4|SYT_RHORT Threonine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=thrS PE=3 SV=1 113 760 6.0E-157
sp|Q30Y11|SYT_DESAG Threonine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=thrS PE=3 SV=1 134 739 1.0E-156
sp|Q6M9L0|SYT_PARUW Threonine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=thrS PE=3 SV=1 126 768 2.0E-156
sp|A8GR83|SYT_RICRS Threonine--tRNA ligase OS=Rickettsia rickettsii (strain Sheila Smith) GN=thrS PE=3 SV=1 113 737 2.0E-156
sp|C5CI64|SYT_KOSOT Threonine--tRNA ligase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=thrS PE=3 SV=1 130 739 3.0E-156
sp|Q0AAL5|SYT_ALKEH Threonine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=thrS PE=3 SV=1 114 742 3.0E-156
sp|Q8R9A4|SYT_CALS4 Threonine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=thrS PE=3 SV=1 131 741 4.0E-156
sp|Q0AY05|SYT_SYNWW Threonine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=thrS PE=3 SV=1 135 741 5.0E-156
sp|Q68XE8|SYT_RICTY Threonine--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=thrS PE=3 SV=1 113 737 1.0E-155
sp|A9BHF0|SYT_PETMO Threonine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=thrS PE=3 SV=1 131 739 2.0E-155
sp|Q189B8|SYT_PEPD6 Threonine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=thrS PE=3 SV=1 135 740 2.0E-155
sp|Q0BXC2|SYT_HYPNA Threonine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=thrS PE=3 SV=1 113 760 5.0E-155
sp|A8GVV1|SYT_RICB8 Threonine--tRNA ligase OS=Rickettsia bellii (strain OSU 85-389) GN=thrS PE=3 SV=1 113 737 5.0E-155
sp|Q1RJ48|SYT_RICBR Threonine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=thrS PE=3 SV=1 113 737 9.0E-155
sp|O05947|SYT_RICPR Threonine--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=thrS PE=3 SV=1 113 737 2.0E-154
sp|Q60AZ3|SYT_METCA Threonine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=thrS PE=3 SV=1 114 759 5.0E-154
sp|B2A5P2|SYT_NATTJ Threonine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=thrS PE=3 SV=1 135 741 8.0E-154
sp|A5WHD5|SYT_PSYWF Threonine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=thrS PE=3 SV=1 113 743 1.0E-153
sp|A8EXW5|SYT_RICCK Threonine--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=thrS PE=3 SV=1 131 753 1.0E-152
sp|A1ARE5|SYT_PELPD Threonine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=thrS PE=3 SV=1 113 743 1.0E-152
sp|Q3A4P3|SYT_PELCD Threonine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=thrS PE=3 SV=1 113 745 2.0E-152
sp|Q1D6E3|SYT_MYXXD Threonine--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=thrS PE=3 SV=1 113 737 2.0E-152
sp|A4XTS1|SYT_PSEMY Threonine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=thrS PE=3 SV=1 114 767 3.0E-152
sp|Q821I3|SYT_CHLCV Threonine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=thrS PE=3 SV=1 114 742 3.0E-152
sp|Q72PK6|SYT_LEPIC Threonine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=thrS PE=3 SV=1 143 745 4.0E-152
sp|Q8F6R1|SYT_LEPIN Threonine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=thrS PE=3 SV=1 143 745 5.0E-152
sp|Q67LA3|SYT_SYMTH Threonine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=thrS PE=3 SV=1 113 739 6.0E-152
sp|Q883H9|SYT_PSESM Threonine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=thrS PE=3 SV=1 114 740 8.0E-152
sp|B1L0T7|SYT_CLOBM Threonine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=thrS PE=3 SV=1 135 771 1.0E-151
sp|C3KTK0|SYT_CLOB6 Threonine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=thrS PE=3 SV=1 135 771 1.0E-151
sp|A4VM22|SYT_PSEU5 Threonine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=thrS PE=3 SV=1 114 740 1.0E-151
sp|Q4ZUG7|SYT_PSEU2 Threonine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=thrS PE=3 SV=1 114 740 2.0E-151
sp|Q82VV1|SYT_NITEU Threonine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=thrS PE=3 SV=1 130 742 2.0E-151
sp|Q256F9|SYT_CHLFF Threonine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=thrS PE=3 SV=1 130 742 4.0E-151
sp|Q63TM2|SYT_BURPS Threonine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=thrS PE=3 SV=1 113 739 4.0E-151
sp|A3N8T1|SYT_BURP6 Threonine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=thrS PE=3 SV=1 113 739 4.0E-151
sp|Q3JT13|SYT_BURP1 Threonine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=thrS PE=3 SV=1 113 739 4.0E-151
sp|A3NUI4|SYT_BURP0 Threonine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=thrS PE=3 SV=1 113 739 4.0E-151
sp|A1V3R3|SYT_BURMS Threonine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=thrS PE=3 SV=1 113 739 4.0E-151
sp|Q62KI2|SYT_BURMA Threonine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=thrS PE=3 SV=1 113 739 4.0E-151
sp|A2S2N6|SYT_BURM9 Threonine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=thrS PE=3 SV=1 113 739 4.0E-151
sp|A3MJT8|SYT_BURM7 Threonine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=thrS PE=3 SV=1 113 739 4.0E-151
sp|B6IV67|SYT_RHOCS Threonine--tRNA ligase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=thrS PE=3 SV=1 113 768 6.0E-151
sp|A6V485|SYT_PSEA7 Threonine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=thrS PE=3 SV=1 115 742 6.0E-151
sp|C5CUU2|SYT_VARPS Threonine--tRNA ligase OS=Variovorax paradoxus (strain S110) GN=thrS PE=3 SV=1 113 742 6.0E-151
sp|Q39H55|SYT_BURL3 Threonine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=thrS PE=3 SV=1 113 739 8.0E-151
sp|Q5L4T1|SYT_CHLAB Threonine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=thrS PE=3 SV=1 130 742 1.0E-150
sp|Q88K27|SYT_PSEPK Threonine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=thrS PE=3 SV=1 114 740 1.0E-150
sp|Q48JS3|SYT_PSE14 Threonine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=thrS PE=3 SV=1 114 740 1.0E-150
sp|Q2SVD8|SYT_BURTA Threonine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=thrS PE=3 SV=1 113 739 1.0E-150
sp|Q8XZ29|SYT_RALSO Threonine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=thrS PE=3 SV=1 113 741 1.0E-150
sp|A4SX33|SYT_POLSQ Threonine--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=thrS PE=3 SV=1 114 739 2.0E-150
sp|C1FKN0|SYT_CLOBJ Threonine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=thrS PE=3 SV=1 135 766 2.0E-150
sp|A5EVK6|SYT_DICNV Threonine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=thrS PE=3 SV=1 114 766 2.0E-150
sp|Q891T0|SYT_CLOTE Threonine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=thrS PE=3 SV=1 135 771 2.0E-150
sp|Q9I099|SYT_PSEAE Threonine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=thrS PE=3 SV=1 115 740 2.0E-150
sp|Q02NP1|SYT_PSEAB Threonine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=thrS PE=3 SV=1 115 740 2.0E-150
sp|B7V188|SYT_PSEA8 Threonine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=thrS PE=3 SV=1 115 740 2.0E-150
sp|Q2SDJ2|SYT_HAHCH Threonine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=thrS PE=3 SV=1 114 739 3.0E-150
sp|Q31F14|SYT_THICR Threonine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=thrS PE=3 SV=1 115 739 3.0E-150
sp|A9ABF9|SYT_BURM1 Threonine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=thrS PE=3 SV=1 113 739 4.0E-150
sp|B1IMV3|SYT_CLOBK Threonine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=thrS PE=3 SV=1 135 766 4.0E-150
sp|A5I6L8|SYT_CLOBH Threonine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=thrS PE=3 SV=1 135 766 4.0E-150
sp|A7FY87|SYT_CLOB1 Threonine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=thrS PE=3 SV=1 135 766 4.0E-150
sp|Q5WT82|SYT_LEGPL Threonine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=thrS PE=3 SV=1 135 740 4.0E-150
sp|A5IAK9|SYT_LEGPC Threonine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=thrS PE=3 SV=1 135 740 5.0E-150
sp|Q472N7|SYT_CUPPJ Threonine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=thrS PE=3 SV=1 113 741 5.0E-150
sp|Q5ZS05|SYT_LEGPH Threonine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=thrS PE=3 SV=2 135 740 6.0E-150
sp|B0KKR8|SYT_PSEPG Threonine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=thrS PE=3 SV=1 114 740 6.0E-150
sp|B4E7I6|SYT_BURCJ Threonine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=thrS PE=3 SV=1 113 739 8.0E-150
sp|Q7NYC6|SYT_CHRVO Threonine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=thrS PE=3 SV=1 130 745 1.0E-149
sp|Q5X1H3|SYT_LEGPA Threonine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=thrS PE=3 SV=1 135 740 1.0E-149
sp|B1J6U4|SYT_PSEPW Threonine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=thrS PE=3 SV=1 114 740 2.0E-149
sp|A4JDU4|SYT_BURVG Threonine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=thrS PE=3 SV=1 113 739 2.0E-149
sp|A5N258|SYT_CLOK5 Threonine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=thrS PE=3 SV=1 113 739 2.0E-149
sp|B9E5W0|SYT_CLOK1 Threonine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=thrS PE=3 SV=1 113 739 2.0E-149
sp|Q11JM1|SYT_CHESB Threonine--tRNA ligase OS=Chelativorans sp. (strain BNC1) GN=thrS PE=3 SV=1 111 760 2.0E-149
sp|A5W5E1|SYT_PSEP1 Threonine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=thrS PE=3 SV=1 114 740 2.0E-149
sp|A7GI05|SYT_CLOBL Threonine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=thrS PE=3 SV=1 135 766 3.0E-149
sp|Q9PJF9|SYT_CHLMU Threonine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=thrS PE=3 SV=1 158 742 3.0E-149
sp|B3R4J1|SYT_CUPTR Threonine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=thrS PE=3 SV=1 113 739 3.0E-149
sp|Q98LR2|SYT_RHILO Threonine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=thrS PE=3 SV=1 131 768 3.0E-149
sp|B4RSL8|SYT_ALTMD Threonine--tRNA ligase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=thrS PE=3 SV=1 114 748 4.0E-149
sp|B2SZG2|SYT_BURPP Threonine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=thrS PE=3 SV=1 113 739 5.0E-149
sp|B2JJJ7|SYT_BURP8 Threonine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=thrS PE=3 SV=1 113 739 5.0E-149
sp|B3PL16|SYT_CELJU Threonine--tRNA ligase OS=Cellvibrio japonicus (strain Ueda107) GN=thrS PE=3 SV=1 114 760 6.0E-149
sp|C0MCN7|SYT_STRS7 Threonine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=thrS PE=3 SV=1 113 751 7.0E-149
sp|Q13WF7|SYT_BURXL Threonine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=thrS PE=3 SV=1 113 739 9.0E-149
sp|C0R403|SYT_WOLWR Threonine--tRNA ligase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=thrS PE=3 SV=1 143 738 9.0E-149
sp|B1K091|SYT_BURCC Threonine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=thrS PE=3 SV=1 113 739 2.0E-148
sp|O84585|SYT_CHLTR Threonine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=thrS PE=3 SV=2 158 742 2.0E-148
sp|Q3KLB6|SYT_CHLTA Threonine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=thrS PE=3 SV=1 158 742 2.0E-148
sp|B0BA34|SYT_CHLTB Threonine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=thrS PE=3 SV=1 158 742 2.0E-148
sp|B0B8F5|SYT_CHLT2 Threonine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=thrS PE=3 SV=1 158 742 2.0E-148
sp|B2V6M2|SYT_SULSY Threonine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=thrS PE=3 SV=1 147 769 2.0E-148
sp|A7I107|SYT_CAMHC Threonine--tRNA ligase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=thrS PE=3 SV=1 148 739 3.0E-148
sp|A1U2C3|SYT_MARHV Threonine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=thrS PE=3 SV=1 114 739 4.0E-148
sp|Q1IC15|SYT_PSEE4 Threonine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=thrS PE=3 SV=1 114 740 4.0E-148
sp|A4G619|SYT_HERAR Threonine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=thrS PE=3 SV=1 113 741 5.0E-148
sp|Q0KBZ3|SYT_CUPNH Threonine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=thrS PE=3 SV=1 113 739 6.0E-148
sp|Q2L2M5|SYT_BORA1 Threonine--tRNA ligase OS=Bordetella avium (strain 197N) GN=thrS PE=3 SV=1 113 738 8.0E-148
sp|Q1Q809|SYT_PSYCK Threonine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=thrS PE=3 SV=1 113 756 1.0E-147
sp|B1YP13|SYT_BURA4 Threonine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=thrS PE=3 SV=1 113 739 1.0E-147
sp|Q74D04|SYT_GEOSL Threonine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=thrS PE=3 SV=2 112 740 1.0E-147
sp|B9KEB1|SYT_CAMLR Threonine--tRNA ligase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=thrS PE=3 SV=1 144 760 1.0E-147
sp|Q3J0X4|SYT_RHOS4 Threonine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=thrS PE=3 SV=1 112 748 1.0E-147
sp|Q5GXY0|SYT_XANOR Threonine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=thrS PE=3 SV=2 113 767 1.0E-147
sp|Q2P0Z5|SYT_XANOM Threonine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=thrS PE=3 SV=1 113 767 1.0E-147
sp|Q73GH6|SYT_WOLPM Threonine--tRNA ligase OS=Wolbachia pipientis wMel GN=thrS PE=3 SV=1 144 738 1.0E-147
sp|Q0BG06|SYT_BURCM Threonine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=thrS PE=3 SV=1 113 739 1.0E-147
sp|B9KKC7|SYT_RHOSK Threonine--tRNA ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=thrS PE=3 SV=1 112 748 2.0E-147
sp|A3PLC6|SYT_RHOS1 Threonine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=thrS PE=3 SV=1 112 748 2.0E-147
sp|B4ETK6|SYT_PROMH Threonine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=thrS PE=3 SV=1 115 739 2.0E-147
sp|A1VBB4|SYT_DESVV Threonine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=thrS PE=3 SV=1 134 761 3.0E-147
sp|Q728R5|SYT_DESVH Threonine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=thrS PE=3 SV=1 134 761 3.0E-147
sp|A1VR77|SYT_POLNA Threonine--tRNA ligase OS=Polaromonas naphthalenivorans (strain CJ2) GN=thrS PE=3 SV=1 113 742 3.0E-147
sp|Q8P7Z2|SYT_XANCP Threonine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=thrS PE=3 SV=1 113 767 3.0E-147
sp|B0RRG9|SYT_XANCB Threonine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=thrS PE=3 SV=1 113 767 3.0E-147
sp|Q4UW57|SYT_XANC8 Threonine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=thrS PE=3 SV=1 113 767 3.0E-147
sp|B8J823|SYT_ANAD2 Threonine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=thrS PE=3 SV=1 113 737 4.0E-147
sp|B9DU13|SYT_STRU0 Threonine--tRNA ligase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=thrS PE=3 SV=1 113 745 5.0E-147
sp|C3MB49|SYT_RHISN Threonine--tRNA ligase OS=Rhizobium sp. (strain NGR234) GN=thrS PE=3 SV=1 130 760 6.0E-147
sp|B4UAM8|SYT_ANASK Threonine--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=thrS PE=3 SV=1 113 737 7.0E-147
sp|Q47CM4|SYT_DECAR Threonine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=thrS PE=3 SV=1 130 742 8.0E-147
sp|Q97GK4|SYT_CLOAB Threonine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=thrS PE=3 SV=1 130 739 8.0E-147
sp|Q8UEL1|SYT_AGRFC Threonine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=thrS PE=3 SV=1 111 760 1.0E-146
sp|A2SH07|SYT_METPP Threonine--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=thrS PE=3 SV=1 113 728 1.0E-146
sp|A8FK07|SYT_CAMJ8 Threonine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=thrS PE=3 SV=1 144 739 2.0E-146
sp|Q4FPW3|SYT_PSYA2 Threonine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=thrS PE=3 SV=1 113 743 2.0E-146
sp|A4WQU1|SYT_RHOS5 Threonine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=thrS PE=3 SV=1 131 769 2.0E-146
sp|Q4FNH9|SYT_PELUB Threonine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=thrS PE=3 SV=1 114 765 3.0E-146
sp|A7HWJ3|SYT_PARL1 Threonine--tRNA ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=thrS PE=3 SV=1 134 760 3.0E-146
sp|Q6N4D3|SYT_RHOPA Threonine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=thrS PE=3 SV=1 111 760 4.0E-146
sp|B0V5P2|SYT_ACIBY Threonine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=thrS PE=3 SV=1 115 739 5.0E-146
sp|A3M299|SYT_ACIBT Threonine--tRNA ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=thrS PE=3 SV=2 115 739 5.0E-146
sp|B2HTH0|SYT_ACIBC Threonine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=thrS PE=3 SV=1 115 739 5.0E-146
sp|B7H005|SYT_ACIB3 Threonine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=thrS PE=3 SV=1 115 739 5.0E-146
sp|A0PZN1|SYT_CLONN Threonine--tRNA ligase OS=Clostridium novyi (strain NT) GN=thrS PE=3 SV=1 131 739 5.0E-146
sp|B5XQC6|SYT_KLEP3 Threonine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=thrS PE=3 SV=1 114 768 6.0E-146
sp|Q04ZG7|SYT_LEPBL Threonine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=thrS PE=3 SV=1 143 745 6.0E-146
sp|Q04R58|SYT_LEPBJ Threonine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=thrS PE=3 SV=1 143 745 6.0E-146
sp|A6U8C7|SYT_SINMW Threonine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=thrS PE=3 SV=1 130 760 7.0E-146
sp|B7I688|SYT_ACIB5 Threonine--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=thrS PE=3 SV=1 115 739 7.0E-146
sp|Q5QYN4|SYT_IDILO Threonine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=thrS PE=3 SV=1 135 770 8.0E-146
sp|Q5HWW3|SYT_CAMJR Threonine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=thrS PE=3 SV=1 144 739 9.0E-146
sp|B9JFG4|SYT_AGRRK Threonine--tRNA ligase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=thrS PE=3 SV=1 135 760 9.0E-146
sp|Q5GSG4|SYT_WOLTR Threonine--tRNA ligase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=thrS PE=3 SV=1 151 738 9.0E-146
sp|C3LUV8|SYT_VIBCM Threonine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=thrS PE=3 SV=1 115 769 1.0E-145
sp|Q9KMN7|SYT_VIBCH Threonine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thrS PE=3 SV=1 115 769 1.0E-145
sp|B2UGJ8|SYT_RALPJ Threonine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=thrS PE=3 SV=1 113 739 1.0E-145
sp|Q5XDC4|SYT_STRP6 Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=thrS PE=3 SV=1 113 745 1.0E-145
sp|B8DPN2|SYT_DESVM Threonine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=thrS PE=3 SV=1 134 743 2.0E-145
sp|Q8PJE1|SYT_XANAC Threonine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=thrS PE=3 SV=1 113 767 2.0E-145
sp|A2C155|SYT_PROM1 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain NATL1A) GN=thrS PE=3 SV=1 115 746 2.0E-145
sp|A5EZ18|SYT_VIBC3 Threonine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=thrS PE=3 SV=1 115 769 2.0E-145
sp|A9IRH6|SYT_BORPD Threonine--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=thrS PE=3 SV=1 113 738 2.0E-145
sp|Q3BRT7|SYT_XANC5 Threonine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=thrS PE=3 SV=1 113 767 2.0E-145
sp|A5G0L2|SYT_ACICJ Threonine--tRNA ligase OS=Acidiphilium cryptum (strain JF-5) GN=thrS PE=3 SV=1 130 756 2.0E-145
sp|Q9A115|SYT_STRP1 Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=thrS PE=3 SV=1 113 745 2.0E-145
sp|B1XYZ3|SYT_LEPCP Threonine--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=thrS PE=3 SV=1 113 742 2.0E-145
sp|A2RFY5|SYT_STRPG Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=thrS PE=3 SV=1 113 745 2.0E-145
sp|Q1JMY5|SYT_STRPC Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=thrS PE=3 SV=1 113 745 2.0E-145
sp|Q1JD10|SYT_STRPB Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=thrS PE=3 SV=1 113 745 2.0E-145
sp|Q8P234|SYT_STRP8 Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=thrS PE=3 SV=1 113 745 2.0E-145
sp|Q1MRV8|SYT_LAWIP Threonine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=thrS PE=3 SV=1 152 755 2.0E-145
sp|B0VKJ4|SYT_ACIBS Threonine--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=thrS PE=3 SV=1 115 739 3.0E-145
sp|P0DG59|SYT_STRPQ Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=thrS PE=3 SV=1 113 745 3.0E-145
sp|P0DG58|SYT_STRP3 Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=thrS PE=3 SV=1 113 745 3.0E-145
sp|Q83C10|SYT_COXBU Threonine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=thrS PE=3 SV=1 114 767 3.0E-145
sp|Q2GEB1|SYT_NEOSM Threonine--tRNA ligase OS=Neorickettsia sennetsu (strain Miyayama) GN=thrS PE=3 SV=1 131 737 4.0E-145
sp|A9IVB0|SYT_BART1 Threonine--tRNA ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=thrS PE=3 SV=1 113 737 4.0E-145
sp|Q6F860|SYT_ACIAD Threonine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=thrS PE=3 SV=1 115 739 5.0E-145
sp|B5XKA6|SYT_STRPZ Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=thrS PE=3 SV=1 113 745 5.0E-145
sp|A8F8Q8|SYT_PSELT Threonine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=thrS PE=3 SV=1 113 771 5.0E-145
sp|Q48US7|SYT_STRPM Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=thrS PE=3 SV=1 113 745 5.0E-145
sp|Q1J7X1|SYT_STRPF Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=thrS PE=3 SV=1 113 745 5.0E-145
sp|Q0BRP0|SYT_GRABC Threonine--tRNA ligase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=thrS PE=3 SV=1 130 760 6.0E-145
sp|Q9K095|SYT_NEIMB Threonine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=thrS PE=3 SV=1 113 739 7.0E-145
sp|B0U5E3|SYT_XYLFM Threonine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=thrS PE=3 SV=1 113 738 7.0E-145
sp|B1XV14|SYT_POLNS Threonine--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=thrS PE=3 SV=1 113 739 7.0E-145
sp|Q5FSP9|SYT_GLUOX Threonine--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=thrS PE=3 SV=1 114 762 9.0E-145
sp|Q9Z7A0|SYT_CHLPN Threonine--tRNA ligase OS=Chlamydia pneumoniae GN=thrS PE=3 SV=1 130 742 1.0E-144
sp|A9BAX2|SYT_PROM4 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9211) GN=thrS PE=3 SV=1 115 762 1.0E-144
sp|Q2GBX1|SYT_NOVAD Threonine--tRNA ligase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=thrS PE=3 SV=1 111 761 1.0E-144
sp|Q9PFE2|SYT_XYLFA Threonine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=thrS PE=3 SV=1 113 738 1.0E-144
sp|B3CMJ4|SYT_WOLPP Threonine--tRNA ligase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=thrS PE=3 SV=1 144 738 1.0E-144
sp|Q0ADN4|SYT_NITEC Threonine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=thrS PE=3 SV=1 114 767 2.0E-144
sp|Q87AB2|SYT_XYLFT Threonine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=thrS PE=3 SV=1 113 738 2.0E-144
sp|B2I9P8|SYT_XYLF2 Threonine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=thrS PE=3 SV=1 113 738 2.0E-144
sp|A4W9M3|SYT_ENT38 Threonine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=thrS PE=3 SV=1 114 739 2.0E-144
sp|Q32FI0|SYT_SHIDS Threonine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=thrS PE=3 SV=1 114 739 2.0E-144
sp|C6DYJ5|SYT_GEOSM Threonine--tRNA ligase OS=Geobacter sp. (strain M21) GN=thrS PE=3 SV=1 112 745 2.0E-144
sp|Q1JI30|SYT_STRPD Threonine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=thrS PE=3 SV=1 113 745 3.0E-144
sp|Q6FZZ7|SYT_BARQU Threonine--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=thrS PE=3 SV=1 113 737 3.0E-144
sp|Q9PIS3|SYT_CAMJE Threonine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=thrS PE=3 SV=1 144 739 3.0E-144
sp|A1USJ2|SYT_BARBK Threonine--tRNA ligase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=thrS PE=3 SV=1 113 760 3.0E-144
sp|Q2YBS6|SYT_NITMU Threonine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=thrS PE=3 SV=1 114 739 4.0E-144
sp|Q2IJC0|SYT_ANADE Threonine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=thrS PE=3 SV=1 113 737 4.0E-144
sp|Q6G3K1|SYT_BARHE Threonine--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=thrS PE=3 SV=1 113 737 4.0E-144
sp|A1K4E1|SYT_AZOSB Threonine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=thrS PE=3 SV=1 130 742 4.0E-144
sp|A1SWU5|SYT_PSYIN Threonine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=thrS PE=3 SV=1 115 739 5.0E-144
sp|B6IBD7|SYT_ECOSE Threonine--tRNA ligase OS=Escherichia coli (strain SE11) GN=thrS PE=3 SV=1 114 739 5.0E-144
sp|B1IPK9|SYT_ECOLC Threonine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=thrS PE=3 SV=1 114 739 5.0E-144
sp|A8A0R2|SYT_ECOHS Threonine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=thrS PE=3 SV=1 114 739 5.0E-144
sp|B7L6J2|SYT_ECO55 Threonine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=thrS PE=3 SV=1 114 739 5.0E-144
sp|A7ZMI6|SYT_ECO24 Threonine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=thrS PE=3 SV=1 114 739 5.0E-144
sp|B5ZQK2|SYT_RHILW Threonine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=thrS PE=3 SV=1 135 748 5.0E-144
sp|Q6D4G8|SYT_PECAS Threonine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=thrS PE=3 SV=1 114 739 6.0E-144
sp|Q8Z6I2|SYT_SALTI Threonine--tRNA ligase OS=Salmonella typhi GN=thrS PE=3 SV=1 114 739 6.0E-144
sp|B4TUF0|SYT_SALSV Threonine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=thrS PE=3 SV=1 114 739 6.0E-144
sp|B5F7G2|SYT_SALA4 Threonine--tRNA ligase OS=Salmonella agona (strain SL483) GN=thrS PE=3 SV=1 114 739 6.0E-144
sp|A6L9S2|SYT_PARD8 Threonine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=thrS PE=3 SV=1 113 739 6.0E-144
sp|Q12BR3|SYT_POLSJ Threonine--tRNA ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=thrS PE=3 SV=1 113 728 7.0E-144
sp|Q46LV3|SYT_PROMT Threonine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=thrS PE=3 SV=1 115 740 8.0E-144
sp|Q2K859|SYT_RHIEC Threonine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=thrS PE=3 SV=1 135 748 8.0E-144
sp|A7H1S0|SYT_CAMJD Threonine--tRNA ligase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=thrS PE=3 SV=1 144 739 8.0E-144
sp|A9M375|SYT_NEIM0 Threonine--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=thrS PE=3 SV=1 113 739 8.0E-144
sp|B1JJ17|SYT_YERPY Threonine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=thrS PE=3 SV=1 114 739 8.0E-144
sp|Q669Z0|SYT_YERPS Threonine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=thrS PE=3 SV=1 114 739 8.0E-144
sp|A4TIL1|SYT_YERPP Threonine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=thrS PE=3 SV=1 114 739 8.0E-144
sp|Q1CIG3|SYT_YERPN Threonine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=thrS PE=3 SV=1 114 739 8.0E-144
sp|A9R0A8|SYT_YERPG Threonine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=thrS PE=3 SV=1 114 739 8.0E-144
sp|Q8ZDW5|SYT_YERPE Threonine--tRNA ligase OS=Yersinia pestis GN=thrS PE=3 SV=1 114 739 8.0E-144
sp|B2K668|SYT_YERPB Threonine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=thrS PE=3 SV=1 114 739 8.0E-144
sp|Q1C728|SYT_YERPA Threonine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=thrS PE=3 SV=1 114 739 8.0E-144
sp|A7FHG1|SYT_YERP3 Threonine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=thrS PE=3 SV=1 114 739 8.0E-144
sp|B8GRI1|SYT_THISH Threonine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=thrS PE=3 SV=1 115 739 1.0E-143
sp|Q3Z267|SYT_SHISS Threonine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|P0A8M5|SYT_SHIFL Threonine--tRNA ligase OS=Shigella flexneri GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|Q0T4S9|SYT_SHIF8 Threonine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|Q1RB76|SYT_ECOUT Threonine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|B1LE12|SYT_ECOSM Threonine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|B7N556|SYT_ECOLU Threonine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|P0A8M3|SYT_ECOLI Threonine--tRNA ligase OS=Escherichia coli (strain K12) GN=thrS PE=1 SV=1 114 739 1.0E-143
sp|P0A8M4|SYT_ECOL6 Threonine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|Q0THB0|SYT_ECOL5 Threonine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|A1ABQ2|SYT_ECOK1 Threonine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|B1XGI1|SYT_ECODH Threonine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|C4ZYI1|SYT_ECOBW Threonine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|B7MVJ7|SYT_ECO81 Threonine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|B7NT58|SYT_ECO7I Threonine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|B7MAS9|SYT_ECO45 Threonine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|B7USA2|SYT_ECO27 Threonine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|Q7MK65|SYT_VIBVY Threonine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=thrS PE=3 SV=2 115 739 1.0E-143
sp|B3PNV4|SYT_RHIE6 Threonine--tRNA ligase OS=Rhizobium etli (strain CIAT 652) GN=thrS PE=3 SV=1 135 748 1.0E-143
sp|A1VXT5|SYT_CAMJJ Threonine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=thrS PE=3 SV=1 144 739 1.0E-143
sp|C1CLX1|SYT_STRZP Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain P1031) GN=thrS PE=3 SV=1 113 745 1.0E-143
sp|Q5LTX8|SYT_RUEPO Threonine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=thrS PE=3 SV=1 112 744 1.0E-143
sp|B0BSM2|SYT_ACTPJ Threonine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=thrS PE=3 SV=1 115 739 1.0E-143
sp|B3H061|SYT_ACTP7 Threonine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=thrS PE=3 SV=1 115 739 1.0E-143
sp|B5YQ07|SYT_ECO5E Threonine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|Q8XE27|SYT_ECO57 Threonine--tRNA ligase OS=Escherichia coli O157:H7 GN=thrS PE=3 SV=1 114 739 1.0E-143
sp|Q8KAN0|SYT_CHLTE Threonine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=thrS PE=3 SV=1 110 737 2.0E-143
sp|Q8DA13|SYT_VIBVU Threonine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=thrS PE=3 SV=1 115 739 2.0E-143
sp|Q97PI4|SYT_STRPN Threonine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=thrS PE=1 SV=1 113 745 2.0E-143
sp|C1CSP6|SYT_STRZT Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=thrS PE=3 SV=1 113 745 2.0E-143
sp|B1I703|SYT_STRPI Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=thrS PE=3 SV=1 113 745 2.0E-143
sp|C1C8M1|SYT_STRP7 Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain 70585) GN=thrS PE=3 SV=1 113 745 2.0E-143
sp|Q8E0L9|SYT_STRA5 Threonine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=thrS PE=3 SV=1 113 745 2.0E-143
sp|Q3K1Z4|SYT_STRA1 Threonine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=thrS PE=3 SV=1 113 745 2.0E-143
sp|A0KKP9|SYT_AERHH Threonine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=thrS PE=3 SV=1 115 753 2.0E-143
sp|Q1GZR7|SYT_METFK Threonine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=thrS PE=3 SV=1 114 766 2.0E-143
sp|Q8E693|SYT_STRA3 Threonine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=thrS PE=3 SV=1 113 745 2.0E-143
sp|C3JZN7|SYT_PSEFS Threonine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=thrS PE=3 SV=1 114 740 2.0E-143
sp|C6DFY6|SYT_PECCP Threonine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=thrS PE=3 SV=1 114 739 2.0E-143
sp|Q7VY64|SYT_BORPE Threonine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=thrS PE=3 SV=1 113 738 2.0E-143
sp|Q7W912|SYT_BORPA Threonine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=thrS PE=3 SV=1 113 738 2.0E-143
sp|Q7WKF7|SYT_BORBR Threonine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=thrS PE=3 SV=1 113 738 2.0E-143
sp|A1JMJ9|SYT_YERE8 Threonine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=thrS PE=3 SV=1 114 739 2.0E-143
sp|B5E6Q8|SYT_STRP4 Threonine--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=thrS PE=3 SV=1 113 745 2.0E-143
sp|B5BA42|SYT_SALPK Threonine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=thrS PE=3 SV=1 114 739 3.0E-143
sp|Q5PH96|SYT_SALPA Threonine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=thrS PE=3 SV=1 114 739 3.0E-143
sp|B5EBX9|SYT_GEOBB Threonine--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=thrS PE=3 SV=1 112 745 3.0E-143
sp|Q5F9U4|SYT_NEIG1 Threonine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=thrS PE=3 SV=1 113 739 3.0E-143
sp|Q8ZPS9|SYT_SALTY Threonine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=thrS PE=3 SV=1 114 739 3.0E-143
sp|B4TGH1|SYT_SALHS Threonine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=thrS PE=3 SV=1 114 739 3.0E-143
sp|A3MYU1|SYT_ACTP2 Threonine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=thrS PE=3 SV=1 115 739 3.0E-143
sp|B7M1C7|SYT_ECO8A Threonine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=thrS PE=3 SV=1 114 739 3.0E-143
sp|A8LQX9|SYT_DINSH Threonine--tRNA ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=thrS PE=3 SV=1 112 748 3.0E-143
sp|A6SY30|SYT_JANMA Threonine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=thrS PE=3 SV=1 113 741 4.0E-143
sp|A9N243|SYT_SALPB Threonine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=thrS PE=3 SV=1 114 739 4.0E-143
sp|B4T4M8|SYT_SALNS Threonine--tRNA ligase OS=Salmonella newport (strain SL254) GN=thrS PE=3 SV=1 114 739 4.0E-143
sp|B5QVW8|SYT_SALEP Threonine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=thrS PE=3 SV=1 114 739 4.0E-143
sp|B5FJA8|SYT_SALDC Threonine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=thrS PE=3 SV=1 114 739 4.0E-143
sp|A7N009|SYT_VIBCB Threonine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=thrS PE=3 SV=1 115 739 4.0E-143
sp|B5RAX3|SYT_SALG2 Threonine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=thrS PE=3 SV=1 114 739 4.0E-143
sp|C5BSQ1|SYT_TERTT Threonine--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=thrS PE=3 SV=1 114 740 4.0E-143
sp|B7LQ71|SYT_ESCF3 Threonine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=thrS PE=3 SV=1 114 739 5.0E-143
sp|Q321L0|SYT_SHIBS Threonine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=thrS PE=3 SV=1 114 739 5.0E-143
sp|B2U397|SYT_SHIB3 Threonine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=thrS PE=3 SV=1 114 739 5.0E-143
sp|Q6MML0|SYT_BDEBA Threonine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=thrS PE=3 SV=1 112 740 5.0E-143
sp|C1DF42|SYT_AZOVD Threonine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=thrS PE=3 SV=1 115 740 5.0E-143
sp|B9JWF4|SYT_AGRVS Threonine--tRNA ligase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=thrS PE=3 SV=1 135 760 6.0E-143
sp|Q92QB0|SYT_RHIME Threonine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=thrS PE=3 SV=1 130 760 6.0E-143
sp|Q57PV3|SYT_SALCH Threonine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=thrS PE=3 SV=1 114 739 6.0E-143
sp|C1D0W2|SYT_DEIDV Threonine--tRNA ligase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=thrS PE=3 SV=1 113 749 6.0E-143
sp|Q5NPH1|SYT_ZYMMO Threonine--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=thrS PE=3 SV=1 111 737 7.0E-143
sp|A6VNZ2|SYT_ACTSZ Threonine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=thrS PE=3 SV=1 115 739 7.0E-143
sp|C1CFK0|SYT_STRZJ Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain JJA) GN=thrS PE=3 SV=1 113 745 7.0E-143
sp|Q3JC02|SYT_NITOC Threonine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=thrS PE=3 SV=1 114 742 8.0E-143
sp|Q1GFW2|SYT_RUEST Threonine--tRNA ligase OS=Ruegeria sp. (strain TM1040) GN=thrS PE=3 SV=1 112 745 8.0E-143
sp|Q9JVA3|SYT_NEIMA Threonine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=thrS PE=3 SV=1 113 739 9.0E-143
sp|Q65TQ0|SYT_MANSM Threonine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=thrS PE=3 SV=1 135 739 9.0E-143
sp|P57857|SYT_PASMU Threonine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=thrS PE=3 SV=1 115 739 1.0E-142
sp|A3PBX1|SYT_PROM0 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=thrS PE=3 SV=1 115 737 1.0E-142
sp|B2VEM1|SYT_ERWT9 Threonine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=thrS PE=3 SV=1 114 739 1.0E-142
sp|B5EN57|SYT_ACIF5 Threonine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=thrS PE=3 SV=1 115 742 1.0E-142
sp|B7J7T0|SYT_ACIF2 Threonine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=thrS PE=3 SV=1 115 742 1.0E-142
sp|C4LFH3|SYT_TOLAT Threonine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=thrS PE=3 SV=1 114 739 2.0E-142
sp|Q1QWK7|SYT_CHRSD Threonine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=thrS PE=3 SV=1 115 739 2.0E-142
sp|A8GDQ5|SYT_SERP5 Threonine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=thrS PE=3 SV=1 114 739 2.0E-142
sp|Q57D65|SYT_BRUAB Threonine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=thrS PE=3 SV=1 131 760 2.0E-142
sp|Q2YQ07|SYT_BRUA2 Threonine--tRNA ligase OS=Brucella abortus (strain 2308) GN=thrS PE=3 SV=1 131 760 2.0E-142
sp|B2S5S6|SYT_BRUA1 Threonine--tRNA ligase OS=Brucella abortus (strain S19) GN=thrS PE=3 SV=1 131 760 2.0E-142
sp|Q7N3P6|SYT_PHOLL Threonine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=thrS PE=3 SV=1 114 739 2.0E-142
sp|A2BQ78|SYT_PROMS Threonine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=thrS PE=3 SV=1 115 737 2.0E-142
sp|Q31BT7|SYT_PROM9 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=thrS PE=3 SV=1 115 740 3.0E-142
sp|C0Q647|SYT_SALPC Threonine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=thrS PE=3 SV=1 114 739 3.0E-142
sp|A1TR39|SYT_ACIAC Threonine--tRNA ligase OS=Acidovorax citrulli (strain AAC00-1) GN=thrS PE=3 SV=1 113 728 3.0E-142
sp|B2FN79|SYT_STRMK Threonine--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=thrS PE=3 SV=1 113 739 3.0E-142
sp|Q8DNX8|SYT_STRR6 Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=thrS PE=3 SV=2 113 745 4.0E-142
sp|B8ZM32|SYT_STRPJ Threonine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=thrS PE=3 SV=1 113 745 4.0E-142
sp|Q04JD7|SYT_STRP2 Threonine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=thrS PE=3 SV=1 113 745 4.0E-142
sp|Q1MGA7|SYT_RHIL3 Threonine--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=thrS PE=3 SV=1 111 748 4.0E-142
sp|Q21KE0|SYT_SACD2 Threonine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=thrS PE=3 SV=1 114 739 4.0E-142
sp|Q8DT12|SYT_STRMU Threonine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=thrS PE=3 SV=1 130 751 4.0E-142
sp|Q8YH89|SYT_BRUME Threonine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=thrS PE=3 SV=1 131 760 4.0E-142
sp|Q480A9|SYT_COLP3 Threonine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=thrS PE=3 SV=1 114 746 4.0E-142
sp|A8AWB7|SYT_STRGC Threonine--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=thrS PE=3 SV=1 113 745 7.0E-142
sp|Q8G0L8|SYT_BRUSU Threonine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=thrS PE=3 SV=1 131 760 7.0E-142
sp|B0CGM0|SYT_BRUSI Threonine--tRNA ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=thrS PE=3 SV=1 131 760 7.0E-142
sp|A9M582|SYT_BRUC2 Threonine--tRNA ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=thrS PE=3 SV=1 131 760 7.0E-142
sp|C0RJ44|SYT_BRUMB Threonine--tRNA ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=thrS PE=3 SV=1 131 760 8.0E-142
sp|A2BVR0|SYT_PROM5 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=thrS PE=3 SV=1 115 740 1.0E-141
sp|B6YQ95|SYT_AZOPC Threonine--tRNA ligase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=thrS PE=3 SV=1 113 773 1.0E-141
sp|Q87Q70|SYT_VIBPA Threonine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thrS PE=3 SV=1 115 769 2.0E-141
sp|Q2WAI1|SYT_MAGSA Threonine--tRNA ligase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=thrS PE=3 SV=1 113 760 2.0E-141
sp|A4Y706|SYT_SHEPC Threonine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=thrS PE=3 SV=1 114 740 3.0E-141
sp|A1RJI3|SYT_SHESW Threonine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=thrS PE=3 SV=1 114 740 3.0E-141
sp|Q3KEY2|SYT_PSEPF Threonine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=thrS PE=3 SV=1 114 740 3.0E-141
sp|B4SQH4|SYT_STRM5 Threonine--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=thrS PE=3 SV=1 113 766 4.0E-141
sp|A9HFP5|SYT_GLUDA Threonine--tRNA ligase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=thrS PE=3 SV=1 130 737 4.0E-141
sp|B8J4E4|SYT_DESDA Threonine--tRNA ligase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=thrS PE=3 SV=1 124 740 5.0E-141
sp|A8H4U6|SYT_SHEPA Threonine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=thrS PE=3 SV=1 114 740 5.0E-141
sp|A9C3D4|SYT_DELAS Threonine--tRNA ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=thrS PE=3 SV=1 113 728 8.0E-141
sp|A1W8I6|SYT_ACISJ Threonine--tRNA ligase OS=Acidovorax sp. (strain JS42) GN=thrS PE=3 SV=1 113 728 1.0E-140
sp|Q9RSP3|SYT_DEIRA Threonine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=thrS PE=3 SV=1 115 746 1.0E-140
sp|Q7VKR9|SYT_HAEDU Threonine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=thrS PE=3 SV=1 115 739 1.0E-140
sp|A3CP56|SYT_STRSV Threonine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=thrS PE=3 SV=1 113 770 1.0E-140
sp|A8G3W3|SYT_PROM2 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=thrS PE=3 SV=1 115 743 2.0E-140
sp|C6BRH1|SYT_DESAD Threonine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=thrS PE=3 SV=1 134 751 2.0E-140
sp|Q7VBM8|SYT_PROMA Threonine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=thrS PE=3 SV=1 115 738 2.0E-140
sp|A1AWT6|SYT_RUTMC Threonine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=thrS PE=3 SV=1 115 739 2.0E-140
sp|A4SCK4|SYT_CHLPM Threonine--tRNA ligase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=thrS PE=3 SV=1 113 737 3.0E-140
sp|A6VYI1|SYT_MARMS Threonine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=thrS PE=3 SV=1 114 739 3.0E-140
sp|B8F5H9|SYT_HAEPS Threonine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=thrS PE=3 SV=1 115 753 3.0E-140
sp|B9MHX8|SYT_ACIET Threonine--tRNA ligase OS=Acidovorax ebreus (strain TPSY) GN=thrS PE=3 SV=1 113 728 3.0E-140
sp|Q0I3M2|SYT_HAES1 Threonine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=thrS PE=3 SV=1 115 739 3.0E-140
sp|B0UU42|SYT_HISS2 Threonine--tRNA ligase OS=Histophilus somni (strain 2336) GN=thrS PE=3 SV=1 115 739 3.0E-140
sp|Q2NT31|SYT_SODGM Threonine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=thrS PE=3 SV=1 114 739 4.0E-140
sp|Q8EER9|SYT_SHEON Threonine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=thrS PE=3 SV=1 114 740 4.0E-140
sp|A0L4J6|SYT_MAGMM Threonine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=thrS PE=3 SV=1 113 769 4.0E-140
sp|B0TT20|SYT_SHEHH Threonine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=thrS PE=3 SV=1 114 769 5.0E-140
sp|Q082E1|SYT_SHEFN Threonine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=thrS PE=3 SV=1 135 740 6.0E-140
sp|A4SMA4|SYT_AERS4 Threonine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=thrS PE=3 SV=1 115 753 7.0E-140
sp|C5B846|SYT_EDWI9 Threonine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=thrS PE=3 SV=1 114 739 1.0E-139
sp|B3CSS5|SYT_ORITI Threonine--tRNA ligase OS=Orientia tsutsugamushi (strain Ikeda) GN=thrS PE=3 SV=1 113 764 1.0E-139
sp|A5CWF9|SYT_VESOH Threonine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=thrS PE=3 SV=1 115 739 1.0E-139
sp|A5UBX5|SYT_HAEIE Threonine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=thrS PE=3 SV=1 115 739 2.0E-139
sp|A1B0M2|SYT_PARDP Threonine--tRNA ligase OS=Paracoccus denitrificans (strain Pd 1222) GN=thrS PE=3 SV=1 112 760 2.0E-139
sp|B9KH76|SYT_ANAMF Threonine--tRNA ligase OS=Anaplasma marginale (strain Florida) GN=thrS PE=3 SV=1 113 737 2.0E-139
sp|Q7V287|SYT_PROMP Threonine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=thrS PE=3 SV=1 115 743 2.0E-139
sp|C1DDA6|SYT_LARHH Threonine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=thrS PE=3 SV=1 135 766 2.0E-139
sp|A1S6G4|SYT_SHEAM Threonine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=thrS PE=3 SV=1 114 759 2.0E-139
sp|C4K776|SYT_HAMD5 Threonine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=thrS PE=3 SV=1 135 738 2.0E-139
sp|A6QD00|SYT_SULNB Threonine--tRNA ligase OS=Sulfurovum sp. (strain NBC37-1) GN=thrS PE=3 SV=1 144 739 4.0E-139
sp|Q3SK34|SYT_THIDA Threonine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=thrS PE=3 SV=1 113 748 4.0E-139
sp|Q5P9F6|SYT_ANAMM Threonine--tRNA ligase OS=Anaplasma marginale (strain St. Maries) GN=thrS PE=3 SV=1 113 737 4.0E-139
sp|Q4QK77|SYT_HAEI8 Threonine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=thrS PE=3 SV=1 115 739 5.0E-139
sp|Q0HIT9|SYT_SHESM Threonine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=thrS PE=3 SV=1 114 740 6.0E-139
sp|A0KWV4|SYT_SHESA Threonine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=thrS PE=3 SV=1 114 740 6.0E-139
sp|Q0HV45|SYT_SHESR Threonine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=thrS PE=3 SV=1 114 740 6.0E-139
sp|A6WNH2|SYT_SHEB8 Threonine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=thrS PE=3 SV=1 114 740 7.0E-139
sp|A3D4I2|SYT_SHEB5 Threonine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=thrS PE=3 SV=1 114 740 7.0E-139
sp|B8EES6|SYT_SHEB2 Threonine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=thrS PE=3 SV=1 114 740 7.0E-139
sp|A9L2Q9|SYT_SHEB9 Threonine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=thrS PE=3 SV=1 114 740 9.0E-139
sp|A5CD12|SYT_ORITB Threonine--tRNA ligase OS=Orientia tsutsugamushi (strain Boryong) GN=thrS PE=3 SV=1 113 764 1.0E-138
sp|A7ZAZ7|SYT_CAMC1 Threonine--tRNA ligase OS=Campylobacter concisus (strain 13826) GN=thrS PE=3 SV=1 148 760 1.0E-138
sp|A3QEK0|SYT_SHELP Threonine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=thrS PE=3 SV=1 114 740 1.0E-138
sp|Q12NI7|SYT_SHEDO Threonine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=thrS PE=3 SV=1 135 740 2.0E-138
sp|Q5P7X5|SYT_AROAE Threonine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=thrS PE=3 SV=1 114 742 2.0E-138
sp|A4VW43|SYT_STRSY Threonine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=thrS PE=3 SV=1 130 745 2.0E-138
sp|A4W2F0|SYT_STRS2 Threonine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=thrS PE=3 SV=1 130 745 2.0E-138
sp|Q03LP1|SYT_STRTD Threonine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=thrS PE=3 SV=1 113 745 3.0E-138
sp|Q5M5B9|SYT_STRT2 Threonine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=thrS PE=3 SV=1 113 745 3.0E-138
sp|Q5M0T3|SYT_STRT1 Threonine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=thrS PE=3 SV=1 113 745 3.0E-138
sp|B9L5U7|SYT_NAUPA Threonine--tRNA ligase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=thrS PE=3 SV=1 178 760 4.0E-138
sp|A0Q762|SYT_FRATN Threonine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=thrS PE=3 SV=1 135 737 4.0E-138
sp|C4XL11|SYT_DESMR Threonine--tRNA ligase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=thrS PE=3 SV=1 120 743 5.0E-138
sp|B2RJD6|SYT_PORG3 Threonine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=thrS PE=3 SV=1 113 739 7.0E-138
sp|P43014|SYT_HAEIN Threonine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thrS PE=3 SV=1 115 739 9.0E-138
sp|A5UEK1|SYT_HAEIG Threonine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=thrS PE=3 SV=1 135 739 1.0E-137
sp|Q7VJ09|SYT_HELHP Threonine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=thrS PE=3 SV=1 156 743 1.0E-137
sp|B8CME8|SYT_SHEPW Threonine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=thrS PE=3 SV=1 114 769 2.0E-137
sp|Q3YQP0|SYT_EHRCJ Threonine--tRNA ligase OS=Ehrlichia canis (strain Jake) GN=thrS PE=3 SV=1 143 760 2.0E-137
sp|Q9ZMV3|SYT_HELPJ Threonine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=thrS PE=3 SV=1 181 761 2.0E-137
sp|B2URV1|SYT_HELPS Threonine--tRNA ligase OS=Helicobacter pylori (strain Shi470) GN=thrS PE=3 SV=1 181 761 2.0E-137
sp|B5Z9Q1|SYT_HELPG Threonine--tRNA ligase OS=Helicobacter pylori (strain G27) GN=thrS PE=3 SV=1 181 761 2.0E-137
sp|B3QUU7|SYT_CHLT3 Threonine--tRNA ligase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=thrS PE=3 SV=1 111 769 2.0E-137
sp|A4IX68|SYT_FRATW Threonine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=thrS PE=3 SV=1 135 737 2.0E-137
sp|Q5NGL8|SYT_FRATT Threonine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=thrS PE=3 SV=1 135 737 2.0E-137
sp|Q14I20|SYT_FRAT1 Threonine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=thrS PE=3 SV=1 135 737 2.0E-137
sp|B2SGS3|SYT_FRATM Threonine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=thrS PE=3 SV=1 135 737 3.0E-137
sp|B0TY89|SYT_FRAP2 Threonine--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=thrS PE=3 SV=1 135 742 4.0E-137
sp|Q2GI92|SYT_EHRCR Threonine--tRNA ligase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=thrS PE=3 SV=1 143 760 5.0E-137
sp|A7GVZ2|SYT_CAMC5 Threonine--tRNA ligase OS=Campylobacter curvus (strain 525.92) GN=thrS PE=3 SV=1 170 760 5.0E-137
sp|B1KG61|SYT_SHEWM Threonine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=thrS PE=3 SV=1 114 740 7.0E-137
sp|A8FV56|SYT_SHESH Threonine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=thrS PE=3 SV=1 114 740 8.0E-137
sp|Q1CV33|SYT_HELPH Threonine--tRNA ligase OS=Helicobacter pylori (strain HPAG1) GN=thrS PE=3 SV=1 181 761 9.0E-137
sp|Q7MVQ5|SYT_PORGI Threonine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=thrS PE=3 SV=1 113 739 1.0E-136
sp|Q7V8D2|SYT_PROMM Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=thrS PE=3 SV=1 115 740 1.0E-136
sp|Q1GVA9|SYT_SPHAL Threonine--tRNA ligase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=thrS PE=3 SV=1 113 761 2.0E-136
sp|B6JPM2|SYT_HELP2 Threonine--tRNA ligase OS=Helicobacter pylori (strain P12) GN=thrS PE=3 SV=1 181 761 2.0E-136
sp|Q0BL41|SYT_FRATO Threonine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=thrS PE=3 SV=1 135 737 2.0E-136
sp|Q49YB4|SYT_STAS1 Threonine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=thrS PE=3 SV=1 111 751 2.0E-136
sp|A2CAU4|SYT_PROM3 Threonine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=thrS PE=3 SV=1 115 740 3.0E-136
sp|Q2FXP7|SYT_STAA8 Threonine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=thrS PE=3 SV=1 111 751 3.0E-136
sp|Q2A2J0|SYT_FRATH Threonine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=thrS PE=3 SV=1 135 737 3.0E-136
sp|A7NDB6|SYT_FRATF Threonine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=thrS PE=3 SV=1 135 737 3.0E-136
sp|B4SB93|SYT_PELPB Threonine--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=thrS PE=3 SV=1 113 737 7.0E-136
sp|Q2YTA7|SYT_STAAB Threonine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=thrS PE=3 SV=1 111 751 7.0E-136
sp|Q8NW68|SYT_STAAW Threonine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=thrS PE=1 SV=1 111 751 7.0E-136
sp|A8Z2J8|SYT_STAAT Threonine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=thrS PE=3 SV=1 111 751 7.0E-136
sp|Q6G8P3|SYT_STAAS Threonine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=thrS PE=3 SV=1 111 751 7.0E-136
sp|Q6GG23|SYT_STAAR Threonine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=thrS PE=3 SV=1 111 751 7.0E-136
sp|A6QHL6|SYT_STAAE Threonine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=thrS PE=3 SV=1 111 751 7.0E-136
sp|Q5HF90|SYT_STAAC Threonine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=thrS PE=3 SV=1 111 751 7.0E-136
sp|A5ITK7|SYT_STAA9 Threonine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=thrS PE=3 SV=1 111 751 7.0E-136
sp|Q2FG54|SYT_STAA3 Threonine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=thrS PE=3 SV=1 111 751 7.0E-136
sp|A6U2F0|SYT_STAA2 Threonine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=thrS PE=3 SV=1 111 751 7.0E-136
sp|Q1IY82|SYT_DEIGD Threonine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=thrS PE=3 SV=1 113 739 1.0E-135
sp|Q17VZ5|SYT_HELAH Threonine--tRNA ligase OS=Helicobacter acinonychis (strain Sheeba) GN=thrS PE=3 SV=1 181 761 1.0E-135
sp|P56071|SYT_HELPY Threonine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=thrS PE=3 SV=1 181 761 1.0E-135
sp|Q73NR2|SYT_TREDE Threonine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=thrS PE=3 SV=1 185 739 2.0E-135
sp|P56881|SYT_THET8 Threonine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=thrS PE=1 SV=1 113 770 2.0E-135
sp|Q168U9|SYT_ROSDO Threonine--tRNA ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=thrS PE=3 SV=1 112 744 2.0E-135
sp|Q2N6X5|SYT_ERYLH Threonine--tRNA ligase OS=Erythrobacter litoralis (strain HTCC2594) GN=thrS PE=3 SV=1 111 760 5.0E-135
sp|A1WMG5|SYT_VEREI Threonine--tRNA ligase OS=Verminephrobacter eiseniae (strain EF01-2) GN=thrS PE=3 SV=1 113 728 5.0E-135
sp|Q72HH1|SYT_THET2 Threonine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=thrS PE=3 SV=1 113 770 1.0E-134
sp|P67585|SYT_STAAN Threonine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=thrS PE=1 SV=1 111 751 1.0E-134
sp|P67584|SYT_STAAM Threonine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=thrS PE=3 SV=1 111 751 1.0E-134
sp|A7X3A6|SYT_STAA1 Threonine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=thrS PE=3 SV=1 111 751 1.0E-134
sp|Q5FGP1|SYT_EHRRG Threonine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=thrS PE=3 SV=1 143 737 2.0E-134
sp|O67583|SYT_AQUAE Threonine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=thrS PE=3 SV=1 152 741 2.0E-134
sp|Q5H9Z4|SYT_EHRRW Threonine--tRNA ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=thrS PE=3 SV=1 143 737 2.0E-134
sp|B4S3D2|SYT_PROA2 Threonine--tRNA ligase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=thrS PE=3 SV=1 120 758 3.0E-134
sp|Q9K866|SYT_BACHD Threonine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=thrS PE=3 SV=1 130 762 4.0E-134
sp|B3EKG9|SYT_CHLPB Threonine--tRNA ligase OS=Chlorobium phaeobacteroides (strain BS1) GN=thrS PE=3 SV=1 113 737 6.0E-134
sp|B7GGN9|SYT_ANOFW Threonine--tRNA ligase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=thrS PE=3 SV=1 130 762 1.0E-133
sp|Q11UK3|SYT_CYTH3 Threonine--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=thrS PE=3 SV=1 113 737 3.0E-133
sp|C1F9K5|SYT_ACIC5 Threonine--tRNA ligase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=thrS PE=3 SV=1 111 751 1.0E-132
[Show less]

GO

GO Term Description Terminal node
GO:0043039 tRNA aminoacylation Yes
GO:0005524 ATP binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0000166 nucleotide binding Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0005488 binding No
GO:0006082 organic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043038 amino acid activation No
GO:0032555 purine ribonucleotide binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043167 ion binding No
GO:0044281 small molecule metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0006520 cellular amino acid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:1901265 nucleoside phosphate binding No
GO:0006399 tRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0034660 ncRNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032553 ribonucleotide binding No
GO:0019752 carboxylic acid metabolic process No
GO:0016874 ligase activity No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3158
MDGVCFVKPRICRSGRQPPPPPPRRTSFEDNLDDIAISLTRLTMSSDAHKAAEVQGIPLRSSKQPKEKGSKPSKD
AGLELPTLPDFVQHRLDVFDRLKARQDAELAAKPREEITVSLPNDKEEKGTSWETTPAAIAKAISKSLLERTVIS
RVDGELWDLTRPLEKSCKLELIDFEDIEGKKVFWHSSAHILGEAAERRFGCYLCNGPPTEDPPGFYYDMANMEGA
VVADEDKKALETLSSSIIKERQPFERLEMTKDELLEMFKYSKYKEYFINQRVPDGTRSTVYRCGPLIDLCRGPHV
PHTGNIKAFSVLRNSAAYWLGDSKNESVQRIAGISFPDKKQLDEYKTFLAEAAKRNHRKIGQDQKLFFWDEMSPG
STFWLPHGTRIYNALMDLIKGEYRTRGFVEVMSPNMYKADLWKVSGHWNHYEENMFTFEVEKEKFGLKPMNCPGH
CKIFAHSDVTYRELPWRMADFGVLHRNEFSGALSGLTRVRRFQQDDAHIFCTVDQIRDEIEGAFDFLYAVYGLFG
FSFKLKLSRRPEKYIGEISLWDMAEAKLKDALDAFTGRIGAKWEENPGDGAFYGPKIDITVYDALRREHQCGTIQ
LDFNLPRRFKLRYVAAKGEGAAADDEDLPAGYGRPVMIHRAVLGSFERMIGILTEHFAGKWPFWLSPRQVLVVPV
MPGVNDYAQEVQKALHEAGLFADADLSGNTFQKKIRTGQLEQYNFIFVVGAEEAKSRTVNIRNRDDQSTQKHGEL
IPLQEALSHLEKLKSERRLENKW
Coding >Ophio5|3158
ATGGATGGAGTCTGCTTCGTCAAGCCGAGGATCTGCCGCTCAGGCCGCCAACCCCCCCCTCCCCCACCTCGGCGC
ACAAGTTTTGAAGACAACTTGGACGACATCGCCATCTCCCTTACACGCCTCACCATGTCATCTGATGCTCATAAG
GCCGCCGAGGTCCAAGGTATTCCCTTGCGATCCTCCAAGCAGCCCAAGGAAAAGGGCTCCAAACCCTCCAAGGAC
GCAGGGCTCGAGCTGCCGACGCTTCCCGACTTTGTCCAGCATCGGCTCGACGTCTTCGACCGGTTAAAAGCCAGG
CAAGACGCGGAGCTTGCCGCGAAACCGCGTGAGGAAATCACTGTTTCGCTCCCCAATGACAAAGAGGAAAAGGGA
ACCTCGTGGGAAACGACGCCCGCCGCCATCGCCAAGGCCATTTCCAAGTCCCTGCTTGAGCGCACCGTCATCTCC
CGTGTCGATGGAGAGCTCTGGGACCTCACACGGCCTCTGGAGAAGAGCTGCAAGCTGGAGCTGATTGACTTTGAA
GATATCGAGGGCAAGAAGGTTTTCTGGCACTCATCGGCTCATATCCTCGGAGAGGCAGCCGAGAGACGGTTCGGC
TGCTATCTCTGCAACGGTCCCCCGACAGAGGACCCGCCAGGCTTCTACTATGATATGGCCAACATGGAAGGTGCC
GTGGTGGCCGATGAGGACAAGAAGGCCCTGGAGACGCTGTCTAGTTCCATCATCAAGGAGAGGCAGCCCTTTGAG
CGGCTGGAGATGACCAAGGACGAGCTGCTCGAGATGTTCAAGTACAGCAAGTACAAGGAATACTTCATTAACCAA
CGTGTGCCGGACGGCACCAGGAGCACGGTTTACCGATGCGGTCCGCTCATCGACCTGTGCCGCGGCCCCCACGTG
CCCCATACCGGCAACATCAAGGCCTTTTCCGTCCTCAGGAACTCGGCCGCCTACTGGCTCGGAGACAGCAAAAAC
GAGTCGGTACAGCGCATCGCTGGCATCTCGTTTCCCGACAAGAAGCAGCTCGACGAGTACAAGACGTTCCTGGCC
GAGGCGGCCAAGCGCAACCACCGCAAGATCGGCCAGGACCAGAAGCTCTTCTTCTGGGACGAGATGTCTCCCGGC
TCCACCTTTTGGCTCCCGCACGGCACGAGGATCTACAACGCGCTGATGGACCTGATCAAGGGCGAGTATCGCACC
CGCGGCTTCGTTGAGGTCATGTCTCCCAACATGTACAAGGCGGACCTCTGGAAGGTGTCGGGCCACTGGAACCAC
TACGAGGAGAACATGTTCACGTTTGAGGTGGAGAAGGAGAAGTTTGGGCTGAAGCCGATGAACTGCCCGGGCCAC
TGCAAGATCTTTGCCCACTCCGATGTCACGTACCGGGAGCTGCCCTGGCGCATGGCCGACTTTGGCGTCCTCCAC
CGCAACGAGTTCTCGGGCGCGCTGTCGGGGCTGACGCGCGTGCGCCGCTTCCAGCAGGACGACGCGCACATATTC
TGCACGGTTGATCAGATTCGCGACGAGATCGAGGGCGCCTTTGACTTTTTGTACGCCGTCTACGGGCTGTTCGGC
TTCAGCTTTAAGCTGAAGCTCTCGAGACGGCCCGAAAAGTACATCGGCGAGATTTCGCTCTGGGACATGGCCGAG
GCCAAGCTCAAGGACGCGCTCGACGCCTTCACTGGACGCATCGGGGCCAAGTGGGAGGAGAACCCCGGCGACGGC
GCCTTCTACGGCCCCAAGATCGACATCACAGTGTACGACGCCCTGCGGCGGGAGCACCAGTGCGGCACCATCCAG
CTGGACTTTAACTTGCCGCGGCGGTTCAAGCTGCGGTACGTGGCGGCCAAGGGTGAAGGCGCGGCGGCGGACGAC
GAGGATCTGCCGGCCGGGTACGGGCGGCCGGTGATGATCCACCGGGCGGTGCTGGGGAGCTTTGAGCGCATGATT
GGGATCCTGACGGAGCACTTTGCGGGCAAGTGGCCGTTCTGGCTCAGCCCGCGCCAGGTGCTGGTTGTGCCGGTG
ATGCCGGGCGTCAACGACTACGCGCAGGAGGTGCAGAAGGCGTTGCACGAAGCGGGGCTCTTCGCCGACGCGGAC
CTGAGCGGTAACACGTTCCAGAAGAAGATCCGCACGGGCCAGTTGGAGCAGTACAACTTTATCTTTGTGGTGGGA
GCCGAGGAGGCGAAATCGCGGACGGTCAACATTCGAAACCGCGACGACCAGAGCACGCAGAAGCATGGCGAGCTG
ATTCCGCTGCAGGAGGCACTGAGCCACCTCGAGAAACTCAAGTCGGAGAGGAGACTGGAGAACAAGTGG
Transcript >Ophio5|3158
ATGGATGGAGTCTGCTTCGTCAAGCCGAGGATCTGCCGCTCAGGCCGCCAACCCCCCCCTCCCCCACCTCGGCGC
ACAAGTTTTGAAGACAACTTGGACGACATCGCCATCTCCCTTACACGCCTCACCATGTCATCTGATGCTCATAAG
GCCGCCGAGGTCCAAGGTATTCCCTTGCGATCCTCCAAGCAGCCCAAGGAAAAGGGCTCCAAACCCTCCAAGGAC
GCAGGGCTCGAGCTGCCGACGCTTCCCGACTTTGTCCAGCATCGGCTCGACGTCTTCGACCGGTTAAAAGCCAGG
CAAGACGCGGAGCTTGCCGCGAAACCGCGTGAGGAAATCACTGTTTCGCTCCCCAATGACAAAGAGGAAAAGGGA
ACCTCGTGGGAAACGACGCCCGCCGCCATCGCCAAGGCCATTTCCAAGTCCCTGCTTGAGCGCACCGTCATCTCC
CGTGTCGATGGAGAGCTCTGGGACCTCACACGGCCTCTGGAGAAGAGCTGCAAGCTGGAGCTGATTGACTTTGAA
GATATCGAGGGCAAGAAGGTTTTCTGGCACTCATCGGCTCATATCCTCGGAGAGGCAGCCGAGAGACGGTTCGGC
TGCTATCTCTGCAACGGTCCCCCGACAGAGGACCCGCCAGGCTTCTACTATGATATGGCCAACATGGAAGGTGCC
GTGGTGGCCGATGAGGACAAGAAGGCCCTGGAGACGCTGTCTAGTTCCATCATCAAGGAGAGGCAGCCCTTTGAG
CGGCTGGAGATGACCAAGGACGAGCTGCTCGAGATGTTCAAGTACAGCAAGTACAAGGAATACTTCATTAACCAA
CGTGTGCCGGACGGCACCAGGAGCACGGTTTACCGATGCGGTCCGCTCATCGACCTGTGCCGCGGCCCCCACGTG
CCCCATACCGGCAACATCAAGGCCTTTTCCGTCCTCAGGAACTCGGCCGCCTACTGGCTCGGAGACAGCAAAAAC
GAGTCGGTACAGCGCATCGCTGGCATCTCGTTTCCCGACAAGAAGCAGCTCGACGAGTACAAGACGTTCCTGGCC
GAGGCGGCCAAGCGCAACCACCGCAAGATCGGCCAGGACCAGAAGCTCTTCTTCTGGGACGAGATGTCTCCCGGC
TCCACCTTTTGGCTCCCGCACGGCACGAGGATCTACAACGCGCTGATGGACCTGATCAAGGGCGAGTATCGCACC
CGCGGCTTCGTTGAGGTCATGTCTCCCAACATGTACAAGGCGGACCTCTGGAAGGTGTCGGGCCACTGGAACCAC
TACGAGGAGAACATGTTCACGTTTGAGGTGGAGAAGGAGAAGTTTGGGCTGAAGCCGATGAACTGCCCGGGCCAC
TGCAAGATCTTTGCCCACTCCGATGTCACGTACCGGGAGCTGCCCTGGCGCATGGCCGACTTTGGCGTCCTCCAC
CGCAACGAGTTCTCGGGCGCGCTGTCGGGGCTGACGCGCGTGCGCCGCTTCCAGCAGGACGACGCGCACATATTC
TGCACGGTTGATCAGATTCGCGACGAGATCGAGGGCGCCTTTGACTTTTTGTACGCCGTCTACGGGCTGTTCGGC
TTCAGCTTTAAGCTGAAGCTCTCGAGACGGCCCGAAAAGTACATCGGCGAGATTTCGCTCTGGGACATGGCCGAG
GCCAAGCTCAAGGACGCGCTCGACGCCTTCACTGGACGCATCGGGGCCAAGTGGGAGGAGAACCCCGGCGACGGC
GCCTTCTACGGCCCCAAGATCGACATCACAGTGTACGACGCCCTGCGGCGGGAGCACCAGTGCGGCACCATCCAG
CTGGACTTTAACTTGCCGCGGCGGTTCAAGCTGCGGTACGTGGCGGCCAAGGGTGAAGGCGCGGCGGCGGACGAC
GAGGATCTGCCGGCCGGGTACGGGCGGCCGGTGATGATCCACCGGGCGGTGCTGGGGAGCTTTGAGCGCATGATT
GGGATCCTGACGGAGCACTTTGCGGGCAAGTGGCCGTTCTGGCTCAGCCCGCGCCAGGTGCTGGTTGTGCCGGTG
ATGCCGGGCGTCAACGACTACGCGCAGGAGGTGCAGAAGGCGTTGCACGAAGCGGGGCTCTTCGCCGACGCGGAC
CTGAGCGGTAACACGTTCCAGAAGAAGATCCGCACGGGCCAGTTGGAGCAGTACAACTTTATCTTTGTGGTGGGA
GCCGAGGAGGCGAAATCGCGGACGGTCAACATTCGAAACCGCGACGACCAGAGCACGCAGAAGCATGGCGAGCTG
ATTCCGCTGCAGGAGGCACTGAGCCACCTCGAGAAACTCAAGTCGGAGAGGAGACTGGAGAACAAGTGGTGA
Gene >Ophio5|3158
ATGGATGGAGTCTGCTTCGTCAAGCCGAGGATCTGCCGCTCAGGCCGCCAACCCCCCCCTCCCCCACCTCGGCGC
ACAAGTTTTGAAGACAACTTGGACGACATCGCCATCTCCCTTACACGCCTCACCATGTCATCTGATGCTCATAAG
GCCGCCGAGGTCCAAGGTATTCCCTTGCGATCCTCCAAGCAGCCCAAGGAAAAGGGCTCCAAACCCTCCAAGGAC
GCAGGGCTCGAGGTCCGTCACCAACACCCCCGTCTCCCTTTGCCGCGCCATTGTGCTGAGCCTGCGACAGCTGCC
GACGCTTCCCGACTTTGTCCAGCATCGGCTCGACGTCTTCGACCGGTTAAAAGCCAGGCAAGACGCGGAGCTTGC
CGGTGCGTTGTACTGCGTCCCTTTGACTAGATGGTGACTAACGTCGGTCGAACAGCGAAACCGCGTGAGGAAATC
ACTGTTTCGCTCCCCAATGACAAAGAGGAAAAGGGAACCTCGTGGGAAACGACGCCCGCCGCCATCGCCAAGGCC
ATTTCCAAGTCCCTGCTTGAGCGCACCGTCATCTCCCGTGTCGATGGAGAGCTCTGGGACCTCACACGGCCTCTG
GAGAAGAGCTGCAAGCTGGAGCTGATTGACTTTGAAGATATCGAGGGTGCGTGTGCCGTTGAACTCCAGCGAAAA
ATAGGCTGTCTGACGCCTTGCGGGACAGGCAAGAAGGTTTTCTGGCACTCATCGGCTCATATCCTCGGAGAGGCA
GCCGAGAGACGGTTCGGCTGCTATCTCTGCAACGGTCCCCCGACAGAGGACCCGCCAGGCTTCTACTATGATATG
GCCAACATGGAAGGGTGCGTCTACCGAGAAGCCGGCTCCGGCCGAATGCTCACGAGCGTGCAGTGCCGTGGTGGC
CGATGAGGACAAGAAGGCCCTGGAGACGCTGTCTAGTTCCATCATCAAGGAGAGGCAGCCCTTTGAGCGGCTGGA
GATGACCAAGGACGAGCTGCTCGAGATGTTCAAGTACAGCAAGTACAAGGAATACTTCATTAACCAACGTGTGCC
GGACGGCACCAGGAGCACGGTTTACCGATGCGGTCCGCTCATCGACCTGTGCCGCGGCCCCCACGTGCCCCATAC
CGGCAACATCAAGGCCTTTTCCGTCCTCAGGGTACGTACGTCCGTGACACCGACTACGCGACGGAGCCAGATTCT
GACGGCGGGTTTAGAACTCGGCCGCCTACTGGCTCGGAGACAGCAAAAACGAGTCGGTACAGCGCATCGCTGGCA
TCTCGTTTCCCGACAAGAAGCAGCTCGACGAGTACAAGACGTTCCTGGCCGAGGCGGCCAAGCGCAACCACCGCA
AGATCGGCCAGGACCAGAAGCTCTTCTTCTGGGACGAGATGTCTCCCGGCTCCACCTTTTGGCTCCCGCACGGCA
CGAGGATCTACAACGCGCTGATGGACCTGATCAAGGGCGAGTATCGCACCCGCGGCTTCGTTGAGGTCATGTCTC
CCAACATGTACAAGGCGGACCTCTGGAAGGTGTCGGGCCACTGGAACCACTACGAGGAGAACATGTTCACGTTTG
AGGTGGAGAAGGAGAAGTTTGGGCTGAAGCCGATGAACTGCCCGGGCCACTGCAAGATCTTTGCCCACTCCGATG
TCACGTACCGGGAGCTGCCCTGGCGCATGGCCGACTTTGGCGTCCTCCACCGCAACGAGTTCTCGGGCGCGCTGT
CGGGGCTGACGCGCGTGCGCCGCTTCCAGCAGGACGACGCGCACATATTCTGCACGGTTGATCAGGTTTGTGGCG
AAAAGGGCCGGCGGTGACGATGAGACGCTGACCAGAGGGGGGGGGGGGGGTTCAGATTCGCGACGAGATCGAGGG
CGCCTTTGACTTTTTGTACGCCGTCTACGGGCTGTTCGGCTTCAGCTTTAAGCTGAAGCTCTCGAGACGGCCCGA
AAAGTACATCGGCGAGATTTCGCTCTGGGACATGGCCGAGGCCAAGCTCAAGGACGCGCTCGACGCCTTCACTGG
ACGCATCGGGGCCAAGTGGGAGGAGAACCCCGGCGACGGCGCCTTCTACGGCCCCAAGATCGACATCACAGTGTA
CGACGCCCTGCGGCGGGAGCACCAGTGCGGCACCATCCAGCTGGACTTTAACTTGCCGCGGCGGTTCAAGCTGCG
GTACGTGGCGGCCAAGGGTGAAGGCGCGGCGGCGGACGACGAGGATCTGCCGGCCGGGTACGGGCGGCCGGTGAT
GATCCACCGGGCGGTGCTGGGGAGCTTTGAGCGCATGATTGGGATCCTGACGGAGCACTTTGCGGGCAAGTGGCC
GTTCTGGCTCAGCCCGCGCCAGGTGCTGGTTGTGCCGGTGATGCCGGGCGTCAACGACTACGCGCAGGAGGTGCA
GAAGGCGTTGCACGAAGCGGGGCTCTTCGCCGACGCGGACCTGAGCGGTAACACGTTCCAGAAGAAGATCCGCAC
GGGCCAGTTGGAGCAGTACAACTTTATCTTTGGTGAGTCTGTCGAGGGAGGGGTTTGCCTCGGAGCGCGGGCTGA
TGAGCGTTGCACAGTGGTGGGAGCCGAGGAGGCGAAATCGCGGACGGTCAACATTCGAAACCGCGACGACCAGAG
CACGCAGAAGCATGGCGAGCTGATTCCGCTGCAGGAGGCACTGAGCCACCTCGAGAAACTCAAGTCGGAGAGGAG
ACTGGAGAACAAGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail