Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3155
Gene name
Locationscaffold_25:57178..58844
Strand+
Gene length (bp)1666
Transcript length (bp)1557
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 9.9E-30 24 125
PF00085 Thioredoxin Thioredoxin 1.3E-26 360 465
PF13848 Thioredoxin_6 Thioredoxin-like domain 1.9E-36 160 335
PF01216 Calsequestrin Calsequestrin 3.7E-07 63 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 22 474 0.0E+00
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 7 499 0.0E+00
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 7 518 0.0E+00
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 22 494 0.0E+00
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 125 444 9.0E-135
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 22 474 0.0E+00
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 7 499 0.0E+00
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 7 518 0.0E+00
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 22 494 0.0E+00
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 125 444 9.0E-135
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 16 501 3.0E-128
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 16 469 4.0E-104
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 21 506 2.0E-99
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 6 468 5.0E-83
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 6 472 4.0E-80
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 22 465 4.0E-80
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 22 465 5.0E-80
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 22 465 2.0E-79
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 22 465 2.0E-79
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 22 465 2.0E-78
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 23 465 5.0E-78
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 1 468 9.0E-78
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 23 467 9.0E-78
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 16 468 3.0E-77
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 23 465 1.0E-76
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 42 499 2.0E-76
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 27 468 2.0E-76
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 27 468 6.0E-76
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 1 464 1.0E-75
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 21 499 1.0E-75
sp|P32474|EUG1_YEAST Protein disulfide-isomerase EUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EUG1 PE=1 SV=1 18 518 1.0E-75
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 6 482 6.0E-74
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 23 511 8.0E-74
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 8 468 3.0E-73
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 28 468 1.0E-72
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 10 463 7.0E-71
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 24 499 4.0E-70
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 27 467 1.0E-69
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 47 468 1.0E-69
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 24 493 2.0E-69
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 24 466 5.0E-69
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 6 466 9.0E-69
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 27 467 2.0E-68
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 21 506 3.0E-68
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 24 466 5.0E-67
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 27 467 9.0E-67
sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 21 495 3.0E-65
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 24 466 8.0E-64
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 27 467 2.0E-63
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 40 492 1.0E-61
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 36 467 2.0E-61
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 44 467 4.0E-61
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 40 510 1.0E-60
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 40 466 4.0E-59
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 44 467 1.0E-58
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 42 478 8.0E-56
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 10 463 3.0E-51
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 7 466 1.0E-50
sp|Q66GQ3|PDI16_ARATH Protein disulfide isomerase-like 1-6 OS=Arabidopsis thaliana GN=PDIL1-6 PE=2 SV=1 17 470 2.0E-42
sp|A3KPF5|PDI15_ARATH Protein disulfide isomerase-like 1-5 OS=Arabidopsis thaliana GN=PDIL1-5 PE=2 SV=1 17 465 6.0E-39
sp|Q5WA72|PDI15_ORYSJ Protein disulfide isomerase-like 1-5 OS=Oryza sativa subsp. japonica GN=PDIL1-5 PE=2 SV=1 17 465 5.0E-36
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 324 484 1.0E-24
sp|Q9DAN1|PDILT_MOUSE Protein disulfide-isomerase-like protein of the testis OS=Mus musculus GN=Pdilt PE=1 SV=2 39 470 4.0E-24
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 360 484 4.0E-24
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 332 479 1.0E-23
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 332 488 7.0E-23
sp|Q95LM0|PDILT_MACFA Protein disulfide-isomerase-like protein of the testis OS=Macaca fascicularis GN=PDILT PE=2 SV=1 39 463 3.0E-22
sp|Q8N807|PDILT_HUMAN Protein disulfide-isomerase-like protein of the testis OS=Homo sapiens GN=PDILT PE=1 SV=2 39 470 4.0E-22
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 25 468 2.0E-21
sp|Q5XI02|PDILT_RAT Protein disulfide-isomerase-like protein of the testis OS=Rattus norvegicus GN=Pdilt PE=1 SV=1 39 470 8.0E-21
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 27 129 8.0E-20
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 367 480 2.0E-19
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 16 226 2.0E-19
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 359 465 3.0E-19
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 23 274 4.0E-19
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 6 125 4.0E-19
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 16 226 4.0E-19
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 363 480 5.0E-19
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 13 225 5.0E-19
sp|Q3T0L2|ERP44_BOVIN Endoplasmic reticulum resident protein 44 OS=Bos taurus GN=ERP44 PE=2 SV=1 5 353 5.0E-19
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 43 342 1.0E-18
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 16 226 1.0E-18
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 357 468 2.0E-18
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 23 226 2.0E-18
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 23 226 2.0E-18
sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=1 SV=1 21 344 2.0E-18
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 23 121 3.0E-18
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 263 465 5.0E-18
sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 44 342 7.0E-18
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 21 157 1.0E-17
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 6 141 1.0E-17
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 4 134 1.0E-17
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 6 141 2.0E-17
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 26 156 2.0E-17
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 39 137 3.0E-17
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 6 141 3.0E-17
sp|Q9D1Q6|ERP44_MOUSE Endoplasmic reticulum resident protein 44 OS=Mus musculus GN=Erp44 PE=1 SV=1 39 353 3.0E-17
sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens GN=ERP44 PE=1 SV=1 5 353 3.0E-17
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 34 157 6.0E-17
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 24 229 7.0E-17
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 358 498 1.0E-16
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 16 141 1.0E-16
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 263 463 1.0E-16
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 20 224 1.0E-16
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 358 465 2.0E-16
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 1 121 3.0E-16
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 6 141 3.0E-16
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 358 465 6.0E-16
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 353 508 6.0E-16
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 10 232 6.0E-16
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 26 229 7.0E-16
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 359 465 1.0E-15
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 27 157 1.0E-15
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 24 184 1.0E-15
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 70 441 1.0E-15
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 359 465 2.0E-15
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 363 467 2.0E-15
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 360 467 2.0E-15
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 367 461 2.0E-15
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 351 467 4.0E-15
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 360 463 4.0E-15
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 377 467 4.0E-15
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 367 461 4.0E-15
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 367 461 5.0E-15
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 5 345 7.0E-15
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 24 157 8.0E-15
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 367 461 9.0E-15
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 24 157 1.0E-14
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 367 461 1.0E-14
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 8 279 2.0E-14
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 22 156 2.0E-14
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 15 175 4.0E-14
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 360 494 4.0E-14
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 27 157 5.0E-14
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 15 103 6.0E-14
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 228 485 7.0E-14
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 35 345 7.0E-14
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 27 104 7.0E-14
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 351 467 1.0E-13
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 351 467 1.0E-13
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 27 145 1.0E-13
sp|Q69SA9|PDI54_ORYSJ Protein disulfide isomerase-like 5-4 OS=Oryza sativa subsp. japonica GN=PDIL5-4 PE=2 SV=1 27 121 1.0E-13
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 351 467 2.0E-13
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 35 345 2.0E-13
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 8 228 3.0E-13
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 25 127 4.0E-13
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 246 472 4.0E-13
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 263 462 6.0E-13
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 1 345 7.0E-13
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 39 465 9.0E-13
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 20 141 1.0E-12
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 6 126 2.0E-12
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 360 462 4.0E-12
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 362 466 5.0E-12
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 14 157 5.0E-12
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 27 103 5.0E-12
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 27 103 5.0E-12
sp|Q8GYD1|PDI51_ARATH Protein disulfide-isomerase 5-1 OS=Arabidopsis thaliana GN=PDIL5-1 PE=2 SV=1 14 129 5.0E-12
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 21 127 6.0E-12
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 34 176 6.0E-12
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 362 466 7.0E-12
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 61 439 7.0E-12
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 61 439 9.0E-12
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 21 131 2.0E-11
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 27 104 2.0E-11
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 367 457 3.0E-11
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 27 103 5.0E-11
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 22 116 5.0E-11
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 353 468 6.0E-11
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 254 464 6.0E-11
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 360 460 8.0E-11
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 354 463 1.0E-10
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 367 462 1.0E-10
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 17 149 1.0E-10
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 17 149 1.0E-10
sp|Q10N04|PDI51_ORYSJ Protein disulfide isomerase-like 5-1 OS=Oryza sativa subsp. japonica GN=PDIL5-1 PE=2 SV=1 22 125 1.0E-10
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 360 460 2.0E-10
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 367 462 2.0E-10
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 17 157 2.0E-10
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 22 116 2.0E-10
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 22 113 2.0E-10
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 353 464 3.0E-10
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 360 460 3.0E-10
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 360 460 3.0E-10
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 19 215 3.0E-10
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 17 157 3.0E-10
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 26 109 3.0E-10
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 26 109 3.0E-10
sp|Q6PKC3|TXD11_HUMAN Thioredoxin domain-containing protein 11 OS=Homo sapiens GN=TXNDC11 PE=1 SV=2 280 463 4.0E-10
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 45 121 4.0E-10
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 61 439 5.0E-10
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 22 116 5.0E-10
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 24 127 6.0E-10
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 360 460 7.0E-10
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 354 466 1.0E-09
sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 379 460 2.0E-09
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 380 462 2.0E-09
sp|P52233|THIO_ACIFR Thioredoxin OS=Acidithiobacillus ferrooxidans GN=trxA PE=3 SV=1 359 463 2.0E-09
sp|Q9LJU2|PDI53_ARATH Protein disulfide-isomerase 5-3 OS=Arabidopsis thaliana GN=PDIL5-3 PE=2 SV=1 27 121 2.0E-09
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 24 127 3.0E-09
sp|Q8K2W3|TXD11_MOUSE Thioredoxin domain-containing protein 11 OS=Mus musculus GN=Txndc11 PE=1 SV=1 280 463 3.0E-09
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 383 463 4.0E-09
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 19 213 4.0E-09
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 24 118 5.0E-09
sp|P14949|THIO_BACSU Thioredoxin OS=Bacillus subtilis (strain 168) GN=trxA PE=1 SV=3 31 122 5.0E-09
sp|A4FUW8|TXD11_BOVIN Thioredoxin domain-containing protein 11 OS=Bos taurus GN=TXNDC11 PE=2 SV=1 253 463 5.0E-09
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 379 465 6.0E-09
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 254 464 6.0E-09
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 26 104 6.0E-09
sp|Q69AB1|TXND8_RAT Thioredoxin domain-containing protein 8 OS=Rattus norvegicus GN=Txndc8 PE=2 SV=1 28 113 6.0E-09
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 358 457 7.0E-09
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 254 464 7.0E-09
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 381 466 1.0E-08
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 24 108 1.0E-08
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 358 446 1.0E-08
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 31 105 1.0E-08
sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=1 SV=1 357 465 2.0E-08
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 19 117 2.0E-08
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 61 439 2.0E-08
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 358 446 2.0E-08
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 24 107 2.0E-08
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 254 464 2.0E-08
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 358 446 2.0E-08
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 16 114 2.0E-08
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 16 114 2.0E-08
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 16 114 2.0E-08
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 16 114 2.0E-08
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 369 442 2.0E-08
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 13 230 3.0E-08
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 374 462 3.0E-08
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 366 462 3.0E-08
sp|P52230|THIO1_STRCO Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 24 107 3.0E-08
sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 32 105 3.0E-08
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 380 462 4.0E-08
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 360 448 4.0E-08
sp|O30974|THIO_MYCSM Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1 356 443 4.0E-08
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 19 203 5.0E-08
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 26 107 5.0E-08
sp|P10472|THIO_CHLTI Thioredoxin OS=Chlorobaculum thiosulfatiphilum GN=trxA PE=1 SV=5 366 466 5.0E-08
sp|Q69AB2|TXND8_MOUSE Thioredoxin domain-containing protein 8 OS=Mus musculus GN=Txndc8 PE=1 SV=1 32 113 6.0E-08
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 24 107 8.0E-08
sp|Q09433|THIO1_CAEEL Thioredoxin-1 OS=Caenorhabditis elegans GN=trx-1 PE=2 SV=1 32 100 8.0E-08
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 24 119 9.0E-08
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 16 137 9.0E-08
sp|Q8BND5|QSOX1_MOUSE Sulfhydryl oxidase 1 OS=Mus musculus GN=Qsox1 PE=1 SV=1 47 106 9.0E-08
sp|Q05739|THIO_STRC2 Thioredoxin OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=trxA PE=1 SV=1 24 128 1.0E-07
sp|O22022|THIO_CYAME Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1 41 104 1.0E-07
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 380 462 2.0E-07
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 330 462 2.0E-07
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 16 187 2.0E-07
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 19 202 2.0E-07
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 367 444 2.0E-07
sp|Q8JGM4|QSOX1_CHICK Sulfhydryl oxidase 1 OS=Gallus gallus GN=QSOX1 PE=1 SV=1 47 106 2.0E-07
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 366 455 2.0E-07
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 26 127 2.0E-07
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 379 463 3.0E-07
sp|P52230|THIO1_STRCO Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 358 465 3.0E-07
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 21 83 4.0E-07
sp|P07887|THIO2_CORNE Thioredoxin C-2 OS=Corynebacterium nephridii PE=1 SV=3 366 466 4.0E-07
sp|P22217|TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3 30 118 4.0E-07
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 362 444 4.0E-07
sp|H2N4I1|QSOX1_PONAB Sulfhydryl oxidase 1 OS=Pongo abelii GN=QSOX1 PE=3 SV=2 47 124 4.0E-07
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 44 114 4.0E-07
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 44 104 4.0E-07
sp|P80579|THIO_ALIAC Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 367 442 5.0E-07
sp|Q6XHI1|THIO2_DROYA Thioredoxin-2 OS=Drosophila yakuba GN=Trx-2 PE=3 SV=1 377 460 5.0E-07
sp|P52232|THIO1_SYNY3 Thioredoxin-like protein slr0233 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0233 PE=1 SV=1 44 104 5.0E-07
sp|Q8S091|TRXF_ORYSJ Thioredoxin F, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0913000 PE=2 SV=1 24 104 5.0E-07
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 367 444 6.0E-07
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 367 444 6.0E-07
sp|Q8K2W3|TXD11_MOUSE Thioredoxin domain-containing protein 11 OS=Mus musculus GN=Txndc11 PE=1 SV=1 32 206 6.0E-07
sp|Q9PJK3|THIO_CHLMU Thioredoxin OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxA PE=3 SV=1 24 121 6.0E-07
sp|Q8LD49|TRXX_ARATH Thioredoxin X, chloroplastic OS=Arabidopsis thaliana GN=ATHX PE=2 SV=2 368 454 6.0E-07
sp|P10473|THIO_RHORU Thioredoxin OS=Rhodospirillum rubrum GN=trxA PE=1 SV=1 24 104 6.0E-07
sp|O48897|TRXF_BRANA Thioredoxin F-type, chloroplastic OS=Brassica napus GN=TRXF PE=2 SV=1 13 129 6.0E-07
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 377 460 6.0E-07
sp|Q5TKD8|TRL2_ORYSJ Thioredoxin-like 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0200100 PE=2 SV=1 23 105 7.0E-07
sp|Q6AX23|QSOX2_XENLA Sulfhydryl oxidase 2 OS=Xenopus laevis GN=qsox2 PE=2 SV=1 39 106 7.0E-07
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 40 118 7.0E-07
sp|P22803|TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX2 PE=1 SV=3 24 118 7.0E-07
sp|O00391|QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens GN=QSOX1 PE=1 SV=3 47 124 8.0E-07
sp|Q8KEA4|THIO1_CHLTE Thioredoxin-1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx1 PE=3 SV=1 364 442 8.0E-07
sp|Q6NPF9|TRXY1_ARATH Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 28 121 8.0E-07
sp|Q99316|MPD2_YEAST Protein disulfide isomerase MPD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD2 PE=1 SV=1 359 496 8.0E-07
sp|P43785|THIO_HAEIN Thioredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxA PE=3 SV=1 367 466 8.0E-07
sp|P59527|THIO_BUCBP Thioredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxA PE=3 SV=1 368 439 9.0E-07
sp|P08628|THIO_RABIT Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 SV=2 24 117 9.0E-07
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 380 473 1.0E-06
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 16 136 1.0E-06
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 16 136 1.0E-06
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 24 112 1.0E-06
sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 372 442 1.0E-06
sp|Q9V429|THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster GN=Trx-2 PE=1 SV=2 377 460 1.0E-06
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 359 444 1.0E-06
sp|Q6IUU3|QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus GN=Qsox1 PE=1 SV=1 47 156 1.0E-06
sp|O84544|THIO_CHLTR Thioredoxin OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxA PE=3 SV=1 24 121 1.0E-06
sp|A2YUQ6|CITRX_ORYSI Thioredoxin-like protein CITRX, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_29059 PE=3 SV=1 21 103 1.0E-06
sp|Q17424|THIO2_CAEEL Probable thioredoxin-2 OS=Caenorhabditis elegans GN=trx-2 PE=3 SV=2 44 114 1.0E-06
sp|P80579|THIO_ALIAC Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 27 125 2.0E-06
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 39 103 2.0E-06
sp|O17486|THIO_ECHGR Thioredoxin OS=Echinococcus granulosus GN=TRX PE=3 SV=2 41 104 2.0E-06
sp|P47370|THIO_MYCGE Thioredoxin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxA PE=3 SV=1 28 107 2.0E-06
sp|Q8L7S9|TRXY2_ARATH Thioredoxin Y2, chloroplastic OS=Arabidopsis thaliana GN=At1g43560 PE=2 SV=1 28 104 2.0E-06
sp|Q4UNK3|THIO_RICFE Thioredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxA PE=3 SV=2 25 121 2.0E-06
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 379 466 2.0E-06
sp|Q9XFH8|TRXF1_ARATH Thioredoxin F1, chloroplastic OS=Arabidopsis thaliana GN=At3g02730 PE=1 SV=2 13 129 2.0E-06
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 359 444 3.0E-06
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 359 444 3.0E-06
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 367 466 3.0E-06
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 41 104 3.0E-06
sp|O51890|THIO_BUCAP Thioredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trxA PE=3 SV=1 366 468 3.0E-06
sp|Q8H2V6|CITRX_ORYSJ Thioredoxin-like protein CITRX, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0378900 PE=2 SV=1 21 103 3.0E-06
sp|O81332|TRXF_MESCR Thioredoxin F-type, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1 24 116 3.0E-06
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 24 104 4.0E-06
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 367 444 4.0E-06
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 363 444 4.0E-06
sp|Q9ZEE0|THIO_RICPR Thioredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=trxA PE=3 SV=2 24 121 4.0E-06
sp|Q9LKW0|CITRX_SOLLC Thioredoxin-like protein CITRX, chloroplastic OS=Solanum lycopersicum GN=CITRX PE=1 SV=1 21 100 4.0E-06
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 31 100 4.0E-06
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 31 100 4.0E-06
sp|Q9R6P9|THIO_MYCGA Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 35 104 5.0E-06
sp|P10599|THIO_HUMAN Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3 24 117 5.0E-06
sp|Q9DGI3|THIO_ICTPU Thioredoxin OS=Ictalurus punctatus GN=txn PE=3 SV=1 24 124 5.0E-06
sp|M1A3D5|CITRX_SOLTU Thioredoxin-like protein CITRX, chloroplastic OS=Solanum tuberosum GN=CITRX PE=3 SV=1 21 100 5.0E-06
sp|P52227|THIO_CHLCV Thioredoxin OS=Chlamydophila caviae (strain GPIC) GN=trxA PE=3 SV=1 24 121 5.0E-06
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 360 444 6.0E-06
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 24 104 7.0E-06
sp|Q9M7X9|CITRX_ARATH Thioredoxin-like protein CITRX, chloroplastic OS=Arabidopsis thaliana GN=CITRX PE=1 SV=1 21 100 7.0E-06
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 40 105 8.0E-06
sp|Q7KQL8|THIO_PLAF7 Thioredoxin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0545 PE=1 SV=1 32 128 8.0E-06
sp|P09856|TRXF_SPIOL Thioredoxin F-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 24 104 8.0E-06
sp|Q9XFH9|TRXF2_ARATH Thioredoxin F2, chloroplastic OS=Arabidopsis thaliana GN=At5g16400 PE=2 SV=1 17 129 8.0E-06
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 39 114 9.0E-06
sp|P52227|THIO_CHLCV Thioredoxin OS=Chlamydophila caviae (strain GPIC) GN=trxA PE=3 SV=1 360 444 9.0E-06
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 358 455 1.0E-05
sp|Q9RD25|THIO2_STRCO Putative thioredoxin-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxC PE=2 SV=1 26 104 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 2125.27 464.53 3786.01
CcL In ants, during behavior modification 527.00 173.06 880.95
CcD In ants, recently dead 567.90 199.18 936.62

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000535 yes
CcL CcD 0.855848 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3155
MYQKSLVLGLATALVGVAMADSDVHQLTTKTFKDFISSNKDNLVLAKFYAPWCGHCKALAPEFEVAATSLKEKQI
KLVKIDCTEEADLCQEHGVEGYPTLKIFQGIENVSPYNGQRKADSIHSHMVKRSMPAVSILAKDTLEDFKTADKV
VVIAYIAADDKASNETFTTLANNLRDEYMFGGVNDDALAEAEGVKFPSVVLYKSFDEGKNNFEGKFEAEALEKFI
KTSATPLVGEVGPETYAGYMSAGIPLGYIFAETPEERESLAKALKPVAEKHKGKVNFATIDAKQFGAHAGNLNLK
TDKFPCFAIQDTGNNKKYPFDQEKEVNHDNIAKFVGDYVAGKVEASIKSEPIPEKQEGAVTVVVAKNYEQIIMDD
TKDVLLEFYAPWCGHCKALAPKYEQLAAQYAESEYKDKIVIAKVDATANDVPDDVAGFPTIKLFPAGAKDAPITY
SGSRTVEDLVTFIKENGKYKAGISIKAEGTDEAAPAATDKDKAEAKKDKADAKKDKEADEAKEDHDEL
Coding >Ophio5|3155
ATGTATCAGAAGAGCCTTGTTCTCGGCCTCGCGACTGCCCTCGTCGGCGTCGCCATGGCCGACTCTGACGTCCAC
CAGCTGACGACCAAGACGTTCAAAGACTTCATTTCCAGCAACAAGGATAACCTCGTCTTGGCCAAGTTCTACGCT
CCCTGGTGTGGCCACTGCAAGGCCCTCGCCCCGGAGTTTGAGGTGGCCGCCACCTCGCTCAAGGAGAAGCAGATC
AAGCTGGTCAAGATCGACTGCACTGAGGAGGCCGATCTCTGCCAGGAGCACGGCGTCGAGGGCTATCCTACCCTC
AAGATTTTCCAAGGTATAGAAAACGTCTCGCCATACAATGGCCAGCGCAAGGCTGACAGCATCCACTCTCACATG
GTCAAGCGTTCTATGCCTGCCGTCTCCATCCTCGCCAAGGATACCCTCGAGGACTTCAAGACGGCTGATAAGGTT
GTCGTGATTGCCTACATTGCCGCCGACGACAAGGCATCTAACGAGACCTTCACCACCCTTGCCAACAACCTGCGG
GATGAATACATGTTCGGAGGTGTCAATGACGACGCCCTTGCCGAGGCCGAGGGCGTCAAGTTCCCCTCCGTCGTT
CTCTACAAGTCCTTTGACGAGGGTAAGAACAACTTCGAAGGAAAGTTTGAGGCCGAGGCCCTCGAGAAGTTCATC
AAGACGTCTGCTACGCCTCTGGTCGGTGAAGTCGGCCCGGAGACGTATGCCGGCTACATGTCTGCCGGTATCCCA
CTTGGCTACATTTTCGCCGAGACGCCAGAGGAGCGCGAATCCCTGGCCAAGGCTCTGAAGCCCGTCGCCGAGAAG
CACAAGGGCAAGGTCAACTTTGCTACCATCGATGCCAAGCAGTTCGGCGCCCACGCCGGCAACCTCAACCTCAAG
ACCGACAAGTTCCCATGCTTCGCCATCCAGGACACCGGCAACAACAAGAAGTATCCCTTCGACCAAGAGAAGGAG
GTTAACCACGACAATATTGCCAAGTTCGTCGGCGATTACGTCGCCGGCAAGGTCGAGGCCAGCATCAAGTCCGAG
CCCATCCCGGAGAAGCAGGAAGGTGCCGTCACCGTCGTCGTCGCCAAGAACTACGAGCAGATCATTATGGATGAC
ACCAAGGACGTGCTGCTTGAATTCTACGCCCCTTGGTGCGGCCACTGCAAGGCTCTGGCTCCCAAGTATGAGCAA
CTGGCGGCCCAGTACGCCGAGAGCGAATACAAGGACAAAATTGTCATCGCAAAGGTCGACGCCACCGCCAACGAC
GTTCCCGACGACGTCGCCGGTTTCCCCACCATTAAGCTGTTCCCCGCCGGCGCAAAGGACGCGCCCATCACCTAC
AGCGGCTCCCGCACCGTTGAGGACCTCGTCACCTTCATCAAAGAGAACGGAAAGTACAAGGCCGGCATCTCCATC
AAGGCCGAGGGCACCGACGAGGCCGCCCCTGCCGCGACCGACAAGGACAAGGCTGAGGCCAAGAAGGACAAGGCC
GATGCCAAGAAGGACAAGGAGGCCGACGAGGCCAAGGAGGACCACGACGAGCTG
Transcript >Ophio5|3155
ATGTATCAGAAGAGCCTTGTTCTCGGCCTCGCGACTGCCCTCGTCGGCGTCGCCATGGCCGACTCTGACGTCCAC
CAGCTGACGACCAAGACGTTCAAAGACTTCATTTCCAGCAACAAGGATAACCTCGTCTTGGCCAAGTTCTACGCT
CCCTGGTGTGGCCACTGCAAGGCCCTCGCCCCGGAGTTTGAGGTGGCCGCCACCTCGCTCAAGGAGAAGCAGATC
AAGCTGGTCAAGATCGACTGCACTGAGGAGGCCGATCTCTGCCAGGAGCACGGCGTCGAGGGCTATCCTACCCTC
AAGATTTTCCAAGGTATAGAAAACGTCTCGCCATACAATGGCCAGCGCAAGGCTGACAGCATCCACTCTCACATG
GTCAAGCGTTCTATGCCTGCCGTCTCCATCCTCGCCAAGGATACCCTCGAGGACTTCAAGACGGCTGATAAGGTT
GTCGTGATTGCCTACATTGCCGCCGACGACAAGGCATCTAACGAGACCTTCACCACCCTTGCCAACAACCTGCGG
GATGAATACATGTTCGGAGGTGTCAATGACGACGCCCTTGCCGAGGCCGAGGGCGTCAAGTTCCCCTCCGTCGTT
CTCTACAAGTCCTTTGACGAGGGTAAGAACAACTTCGAAGGAAAGTTTGAGGCCGAGGCCCTCGAGAAGTTCATC
AAGACGTCTGCTACGCCTCTGGTCGGTGAAGTCGGCCCGGAGACGTATGCCGGCTACATGTCTGCCGGTATCCCA
CTTGGCTACATTTTCGCCGAGACGCCAGAGGAGCGCGAATCCCTGGCCAAGGCTCTGAAGCCCGTCGCCGAGAAG
CACAAGGGCAAGGTCAACTTTGCTACCATCGATGCCAAGCAGTTCGGCGCCCACGCCGGCAACCTCAACCTCAAG
ACCGACAAGTTCCCATGCTTCGCCATCCAGGACACCGGCAACAACAAGAAGTATCCCTTCGACCAAGAGAAGGAG
GTTAACCACGACAATATTGCCAAGTTCGTCGGCGATTACGTCGCCGGCAAGGTCGAGGCCAGCATCAAGTCCGAG
CCCATCCCGGAGAAGCAGGAAGGTGCCGTCACCGTCGTCGTCGCCAAGAACTACGAGCAGATCATTATGGATGAC
ACCAAGGACGTGCTGCTTGAATTCTACGCCCCTTGGTGCGGCCACTGCAAGGCTCTGGCTCCCAAGTATGAGCAA
CTGGCGGCCCAGTACGCCGAGAGCGAATACAAGGACAAAATTGTCATCGCAAAGGTCGACGCCACCGCCAACGAC
GTTCCCGACGACGTCGCCGGTTTCCCCACCATTAAGCTGTTCCCCGCCGGCGCAAAGGACGCGCCCATCACCTAC
AGCGGCTCCCGCACCGTTGAGGACCTCGTCACCTTCATCAAAGAGAACGGAAAGTACAAGGCCGGCATCTCCATC
AAGGCCGAGGGCACCGACGAGGCCGCCCCTGCCGCGACCGACAAGGACAAGGCTGAGGCCAAGAAGGACAAGGCC
GATGCCAAGAAGGACAAGGAGGCCGACGAGGCCAAGGAGGACCACGACGAGCTGTAG
Gene >Ophio5|3155
ATGTATCAGAAGAGCCTTGTTCTCGGCCTCGCGACTGCCCTCGTCGGCGTCGCCATGGCCGACTCTGACGTCCAC
CAGCTGACGACCAAGACGTTCAAAGACTTCATTTCCAGCAACAAGGATAACCTCGTCTTGGCCAAGTGTACGTTG
TTGTGCTGCCCTGTTTGCTTTCGCTTCCTGACGAACCTGGCCGCAGTCTACGCTCCCTGGTGTGGCCACTGCAAG
GCCCTCGCCCCGGAGTTTGAGGTGGCCGCCACCTCGCTCAAGGAGAAGCAGATCAAGCTGGTCAAGATCGACTGC
ACTGAGGAGGCCGATCTCTGCCAGGAGCACGGCGTCGAGGGCTATCCTACCCTCAAGATTTTCCAAGGTATAGAA
AACGTCTCGCCATACAATGGCCAGCGCAAGGCTGACAGGTACACTCTCCCCTTTGTCGTCCCACACCACAATGGC
TGACCATCCACCCTACAGCATCCACTCTCACATGGTCAAGCGTTCTATGCCTGCCGTCTCCATCCTCGCCAAGGA
TACCCTCGAGGACTTCAAGACGGCTGATAAGGTTGTCGTGATTGCCTACATTGCCGCCGACGACAAGGCATCTAA
CGAGACCTTCACCACCCTTGCCAACAACCTGCGGGATGAATACATGTTCGGAGGTGTCAATGACGACGCCCTTGC
CGAGGCCGAGGGCGTCAAGTTCCCCTCCGTCGTTCTCTACAAGTCCTTTGACGAGGGTAAGAACAACTTCGAAGG
AAAGTTTGAGGCCGAGGCCCTCGAGAAGTTCATCAAGACGTCTGCTACGCCTCTGGTCGGTGAAGTCGGCCCGGA
GACGTATGCCGGCTACATGTCTGCCGGTATCCCACTTGGCTACATTTTCGCCGAGACGCCAGAGGAGCGCGAATC
CCTGGCCAAGGCTCTGAAGCCCGTCGCCGAGAAGCACAAGGGCAAGGTCAACTTTGCTACCATCGATGCCAAGCA
GTTCGGCGCCCACGCCGGCAACCTCAACCTCAAGACCGACAAGTTCCCATGCTTCGCCATCCAGGACACCGGCAA
CAACAAGAAGTATCCCTTCGACCAAGAGAAGGAGGTTAACCACGACAATATTGCCAAGTTCGTCGGCGATTACGT
CGCCGGCAAGGTCGAGGCCAGCATCAAGTCCGAGCCCATCCCGGAGAAGCAGGAAGGTGCCGTCACCGTCGTCGT
CGCCAAGAACTACGAGCAGATCATTATGGATGACACCAAGGACGTGCTGCTTGAATTCTACGCCCCTTGGTGCGG
CCACTGCAAGGCTCTGGCTCCCAAGTATGAGCAACTGGCGGCCCAGTACGCCGAGAGCGAATACAAGGACAAAAT
TGTCATCGCAAAGGTCGACGCCACCGCCAACGACGTTCCCGACGACGTCGCCGGTTTCCCCACCATTAAGCTGTT
CCCCGCCGGCGCAAAGGACGCGCCCATCACCTACAGCGGCTCCCGCACCGTTGAGGACCTCGTCACCTTCATCAA
AGAGAACGGAAAGTACAAGGCCGGCATCTCCATCAAGGCCGAGGGCACCGACGAGGCCGCCCCTGCCGCGACCGA
CAAGGACAAGGCTGAGGCCAAGAAGGACAAGGCCGATGCCAAGAAGGACAAGGAGGCCGACGAGGCCAAGGAGGA
CCACGACGAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail