Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3155
Gene name
Locationscaffold_25:57178..58844
Strand+
Gene length (bp)1666
Transcript length (bp)1557
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 9.9E-30 24 125
PF00085 Thioredoxin Thioredoxin 1.3E-26 360 465
PF13848 Thioredoxin_6 Thioredoxin-like domain 1.9E-36 160 335
PF01216 Calsequestrin Calsequestrin 3.7E-07 63 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 22 474 0.0E+00
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 7 499 0.0E+00
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 7 518 0.0E+00
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 22 494 0.0E+00
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 125 444 9.0E-135
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 22 474 0.0E+00
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 7 499 0.0E+00
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 7 518 0.0E+00
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 22 494 0.0E+00
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 125 444 9.0E-135
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 16 501 3.0E-128
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 16 469 4.0E-104
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 21 506 2.0E-99
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 6 468 5.0E-83
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 6 472 4.0E-80
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 22 465 4.0E-80
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 22 465 5.0E-80
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 22 465 2.0E-79
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 22 465 2.0E-79
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 22 465 2.0E-78
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 23 465 5.0E-78
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 1 468 9.0E-78
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 23 467 9.0E-78
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 16 468 3.0E-77
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 23 465 1.0E-76
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 42 499 2.0E-76
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 27 468 2.0E-76
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 27 468 6.0E-76
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 1 464 1.0E-75
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 21 499 1.0E-75
sp|P32474|EUG1_YEAST Protein disulfide-isomerase EUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EUG1 PE=1 SV=1 18 518 1.0E-75
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 6 482 6.0E-74
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 23 511 8.0E-74
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 8 468 3.0E-73
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 28 468 1.0E-72
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 10 463 7.0E-71
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 24 499 4.0E-70
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 27 467 1.0E-69
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 47 468 1.0E-69
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 24 493 2.0E-69
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 24 466 5.0E-69
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 6 466 9.0E-69
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 27 467 2.0E-68
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 21 506 3.0E-68
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 24 466 5.0E-67
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 27 467 9.0E-67
sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 21 495 3.0E-65
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 24 466 8.0E-64
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 27 467 2.0E-63
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 40 492 1.0E-61
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 36 467 2.0E-61
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 44 467 4.0E-61
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 40 510 1.0E-60
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 40 466 4.0E-59
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 44 467 1.0E-58
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 42 478 8.0E-56
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 10 463 3.0E-51
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 7 466 1.0E-50
sp|Q66GQ3|PDI16_ARATH Protein disulfide isomerase-like 1-6 OS=Arabidopsis thaliana GN=PDIL1-6 PE=2 SV=1 17 470 2.0E-42
sp|A3KPF5|PDI15_ARATH Protein disulfide isomerase-like 1-5 OS=Arabidopsis thaliana GN=PDIL1-5 PE=2 SV=1 17 465 6.0E-39
sp|Q5WA72|PDI15_ORYSJ Protein disulfide isomerase-like 1-5 OS=Oryza sativa subsp. japonica GN=PDIL1-5 PE=2 SV=1 17 465 5.0E-36
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 324 484 1.0E-24
sp|Q9DAN1|PDILT_MOUSE Protein disulfide-isomerase-like protein of the testis OS=Mus musculus GN=Pdilt PE=1 SV=2 39 470 4.0E-24
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 360 484 4.0E-24
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 332 479 1.0E-23
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 332 488 7.0E-23
sp|Q95LM0|PDILT_MACFA Protein disulfide-isomerase-like protein of the testis OS=Macaca fascicularis GN=PDILT PE=2 SV=1 39 463 3.0E-22
sp|Q8N807|PDILT_HUMAN Protein disulfide-isomerase-like protein of the testis OS=Homo sapiens GN=PDILT PE=1 SV=2 39 470 4.0E-22
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 25 468 2.0E-21
sp|Q5XI02|PDILT_RAT Protein disulfide-isomerase-like protein of the testis OS=Rattus norvegicus GN=Pdilt PE=1 SV=1 39 470 8.0E-21
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 27 129 8.0E-20
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 367 480 2.0E-19
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 16 226 2.0E-19
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 359 465 3.0E-19
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 23 274 4.0E-19
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 6 125 4.0E-19
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 16 226 4.0E-19
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 363 480 5.0E-19
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 13 225 5.0E-19
sp|Q3T0L2|ERP44_BOVIN Endoplasmic reticulum resident protein 44 OS=Bos taurus GN=ERP44 PE=2 SV=1 5 353 5.0E-19
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 43 342 1.0E-18
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 16 226 1.0E-18
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 357 468 2.0E-18
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 23 226 2.0E-18
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 23 226 2.0E-18
sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=1 SV=1 21 344 2.0E-18
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 23 121 3.0E-18
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 263 465 5.0E-18
sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 44 342 7.0E-18
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 21 157 1.0E-17
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 6 141 1.0E-17
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 4 134 1.0E-17
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 6 141 2.0E-17
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 26 156 2.0E-17
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 39 137 3.0E-17
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 6 141 3.0E-17
sp|Q9D1Q6|ERP44_MOUSE Endoplasmic reticulum resident protein 44 OS=Mus musculus GN=Erp44 PE=1 SV=1 39 353 3.0E-17
sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens GN=ERP44 PE=1 SV=1 5 353 3.0E-17
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 34 157 6.0E-17
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 24 229 7.0E-17
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 358 498 1.0E-16
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 16 141 1.0E-16
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 263 463 1.0E-16
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 20 224 1.0E-16
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 358 465 2.0E-16
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 1 121 3.0E-16
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 6 141 3.0E-16
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 358 465 6.0E-16
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 353 508 6.0E-16
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 10 232 6.0E-16
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 26 229 7.0E-16
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 359 465 1.0E-15
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 27 157 1.0E-15
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 24 184 1.0E-15
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 70 441 1.0E-15
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 359 465 2.0E-15
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 363 467 2.0E-15
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 360 467 2.0E-15
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 367 461 2.0E-15
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 351 467 4.0E-15
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 360 463 4.0E-15
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 377 467 4.0E-15
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 367 461 4.0E-15
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 367 461 5.0E-15
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 5 345 7.0E-15
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 24 157 8.0E-15
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 367 461 9.0E-15
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 24 157 1.0E-14
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 367 461 1.0E-14
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 8 279 2.0E-14
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 22 156 2.0E-14
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 15 175 4.0E-14
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 360 494 4.0E-14
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 27 157 5.0E-14
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 15 103 6.0E-14
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 228 485 7.0E-14
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 35 345 7.0E-14
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 27 104 7.0E-14
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 351 467 1.0E-13
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 351 467 1.0E-13
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 27 145 1.0E-13
sp|Q69SA9|PDI54_ORYSJ Protein disulfide isomerase-like 5-4 OS=Oryza sativa subsp. japonica GN=PDIL5-4 PE=2 SV=1 27 121 1.0E-13
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 351 467 2.0E-13
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 35 345 2.0E-13
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 8 228 3.0E-13
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 25 127 4.0E-13
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 246 472 4.0E-13
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 263 462 6.0E-13
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 1 345 7.0E-13
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 39 465 9.0E-13
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 20 141 1.0E-12
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 6 126 2.0E-12
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 360 462 4.0E-12
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 362 466 5.0E-12
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 14 157 5.0E-12
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 27 103 5.0E-12
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 27 103 5.0E-12
sp|Q8GYD1|PDI51_ARATH Protein disulfide-isomerase 5-1 OS=Arabidopsis thaliana GN=PDIL5-1 PE=2 SV=1 14 129 5.0E-12
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 21 127 6.0E-12
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 34 176 6.0E-12
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 362 466 7.0E-12
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 61 439 7.0E-12
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 61 439 9.0E-12
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 21 131 2.0E-11
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 27 104 2.0E-11
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 367 457 3.0E-11
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 27 103 5.0E-11
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 22 116 5.0E-11
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 353 468 6.0E-11
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 254 464 6.0E-11
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 360 460 8.0E-11
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 354 463 1.0E-10
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 367 462 1.0E-10
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 17 149 1.0E-10
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 17 149 1.0E-10
sp|Q10N04|PDI51_ORYSJ Protein disulfide isomerase-like 5-1 OS=Oryza sativa subsp. japonica GN=PDIL5-1 PE=2 SV=1 22 125 1.0E-10
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 360 460 2.0E-10
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 367 462 2.0E-10
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 17 157 2.0E-10
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 22 116 2.0E-10
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 22 113 2.0E-10
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 353 464 3.0E-10
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 360 460 3.0E-10
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 360 460 3.0E-10
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 19 215 3.0E-10
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 17 157 3.0E-10
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 26 109 3.0E-10
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 26 109 3.0E-10
sp|Q6PKC3|TXD11_HUMAN Thioredoxin domain-containing protein 11 OS=Homo sapiens GN=TXNDC11 PE=1 SV=2 280 463 4.0E-10
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 45 121 4.0E-10
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 61 439 5.0E-10
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 22 116 5.0E-10
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 24 127 6.0E-10
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 360 460 7.0E-10
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 354 466 1.0E-09
sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 379 460 2.0E-09
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 380 462 2.0E-09
sp|P52233|THIO_ACIFR Thioredoxin OS=Acidithiobacillus ferrooxidans GN=trxA PE=3 SV=1 359 463 2.0E-09
sp|Q9LJU2|PDI53_ARATH Protein disulfide-isomerase 5-3 OS=Arabidopsis thaliana GN=PDIL5-3 PE=2 SV=1 27 121 2.0E-09
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 24 127 3.0E-09
sp|Q8K2W3|TXD11_MOUSE Thioredoxin domain-containing protein 11 OS=Mus musculus GN=Txndc11 PE=1 SV=1 280 463 3.0E-09
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 383 463 4.0E-09
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 19 213 4.0E-09
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 24 118 5.0E-09
sp|P14949|THIO_BACSU Thioredoxin OS=Bacillus subtilis (strain 168) GN=trxA PE=1 SV=3 31 122 5.0E-09
sp|A4FUW8|TXD11_BOVIN Thioredoxin domain-containing protein 11 OS=Bos taurus GN=TXNDC11 PE=2 SV=1 253 463 5.0E-09
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 379 465 6.0E-09
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 254 464 6.0E-09
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 26 104 6.0E-09
sp|Q69AB1|TXND8_RAT Thioredoxin domain-containing protein 8 OS=Rattus norvegicus GN=Txndc8 PE=2 SV=1 28 113 6.0E-09
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 358 457 7.0E-09
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 254 464 7.0E-09
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 381 466 1.0E-08
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 24 108 1.0E-08
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 358 446 1.0E-08
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 31 105 1.0E-08
sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=1 SV=1 357 465 2.0E-08
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 19 117 2.0E-08
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 61 439 2.0E-08
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 358 446 2.0E-08
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 24 107 2.0E-08
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 254 464 2.0E-08
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 358 446 2.0E-08
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 16 114 2.0E-08
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 16 114 2.0E-08
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 16 114 2.0E-08
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 16 114 2.0E-08
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 369 442 2.0E-08
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 13 230 3.0E-08
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 374 462 3.0E-08
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 366 462 3.0E-08
sp|P52230|THIO1_STRCO Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 24 107 3.0E-08
sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 32 105 3.0E-08
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 380 462 4.0E-08
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 360 448 4.0E-08
sp|O30974|THIO_MYCSM Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1 356 443 4.0E-08
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 19 203 5.0E-08
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 26 107 5.0E-08
sp|P10472|THIO_CHLTI Thioredoxin OS=Chlorobaculum thiosulfatiphilum GN=trxA PE=1 SV=5 366 466 5.0E-08
sp|Q69AB2|TXND8_MOUSE Thioredoxin domain-containing protein 8 OS=Mus musculus GN=Txndc8 PE=1 SV=1 32 113 6.0E-08
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 24 107 8.0E-08
sp|Q09433|THIO1_CAEEL Thioredoxin-1 OS=Caenorhabditis elegans GN=trx-1 PE=2 SV=1 32 100 8.0E-08
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 24 119 9.0E-08
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 16 137 9.0E-08
sp|Q8BND5|QSOX1_MOUSE Sulfhydryl oxidase 1 OS=Mus musculus GN=Qsox1 PE=1 SV=1 47 106 9.0E-08
sp|Q05739|THIO_STRC2 Thioredoxin OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=trxA PE=1 SV=1 24 128 1.0E-07
sp|O22022|THIO_CYAME Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1 41 104 1.0E-07
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 380 462 2.0E-07
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 330 462 2.0E-07
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 16 187 2.0E-07
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 19 202 2.0E-07
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 367 444 2.0E-07
sp|Q8JGM4|QSOX1_CHICK Sulfhydryl oxidase 1 OS=Gallus gallus GN=QSOX1 PE=1 SV=1 47 106 2.0E-07
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 366 455 2.0E-07
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 26 127 2.0E-07
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 379 463 3.0E-07
sp|P52230|THIO1_STRCO Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 358 465 3.0E-07
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 21 83 4.0E-07
sp|P07887|THIO2_CORNE Thioredoxin C-2 OS=Corynebacterium nephridii PE=1 SV=3 366 466 4.0E-07
sp|P22217|TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3 30 118 4.0E-07
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 362 444 4.0E-07
sp|H2N4I1|QSOX1_PONAB Sulfhydryl oxidase 1 OS=Pongo abelii GN=QSOX1 PE=3 SV=2 47 124 4.0E-07
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 44 114 4.0E-07
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 44 104 4.0E-07
sp|P80579|THIO_ALIAC Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 367 442 5.0E-07
sp|Q6XHI1|THIO2_DROYA Thioredoxin-2 OS=Drosophila yakuba GN=Trx-2 PE=3 SV=1 377 460 5.0E-07
sp|P52232|THIO1_SYNY3 Thioredoxin-like protein slr0233 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0233 PE=1 SV=1 44 104 5.0E-07
sp|Q8S091|TRXF_ORYSJ Thioredoxin F, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0913000 PE=2 SV=1 24 104 5.0E-07
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 367 444 6.0E-07
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 367 444 6.0E-07
sp|Q8K2W3|TXD11_MOUSE Thioredoxin domain-containing protein 11 OS=Mus musculus GN=Txndc11 PE=1 SV=1 32 206 6.0E-07
sp|Q9PJK3|THIO_CHLMU Thioredoxin OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxA PE=3 SV=1 24 121 6.0E-07
sp|Q8LD49|TRXX_ARATH Thioredoxin X, chloroplastic OS=Arabidopsis thaliana GN=ATHX PE=2 SV=2 368 454 6.0E-07
sp|P10473|THIO_RHORU Thioredoxin OS=Rhodospirillum rubrum GN=trxA PE=1 SV=1 24 104 6.0E-07
sp|O48897|TRXF_BRANA Thioredoxin F-type, chloroplastic OS=Brassica napus GN=TRXF PE=2 SV=1 13 129 6.0E-07
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 377 460 6.0E-07
sp|Q5TKD8|TRL2_ORYSJ Thioredoxin-like 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0200100 PE=2 SV=1 23 105 7.0E-07
sp|Q6AX23|QSOX2_XENLA Sulfhydryl oxidase 2 OS=Xenopus laevis GN=qsox2 PE=2 SV=1 39 106 7.0E-07
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 40 118 7.0E-07
sp|P22803|TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX2 PE=1 SV=3 24 118 7.0E-07
sp|O00391|QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens GN=QSOX1 PE=1 SV=3 47 124 8.0E-07
sp|Q8KEA4|THIO1_CHLTE Thioredoxin-1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx1 PE=3 SV=1 364 442 8.0E-07
sp|Q6NPF9|TRXY1_ARATH Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 28 121 8.0E-07
sp|Q99316|MPD2_YEAST Protein disulfide isomerase MPD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD2 PE=1 SV=1 359 496 8.0E-07
sp|P43785|THIO_HAEIN Thioredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxA PE=3 SV=1 367 466 8.0E-07
sp|P59527|THIO_BUCBP Thioredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxA PE=3 SV=1 368 439 9.0E-07
sp|P08628|THIO_RABIT Thioredoxin OS=Oryctolagus cuniculus GN=TXN PE=1 SV=2 24 117 9.0E-07
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 380 473 1.0E-06
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 16 136 1.0E-06
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 16 136 1.0E-06
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 24 112 1.0E-06
sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 372 442 1.0E-06
sp|Q9V429|THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster GN=Trx-2 PE=1 SV=2 377 460 1.0E-06
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 359 444 1.0E-06
sp|Q6IUU3|QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus GN=Qsox1 PE=1 SV=1 47 156 1.0E-06
sp|O84544|THIO_CHLTR Thioredoxin OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxA PE=3 SV=1 24 121 1.0E-06
sp|A2YUQ6|CITRX_ORYSI Thioredoxin-like protein CITRX, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_29059 PE=3 SV=1 21 103 1.0E-06
sp|Q17424|THIO2_CAEEL Probable thioredoxin-2 OS=Caenorhabditis elegans GN=trx-2 PE=3 SV=2 44 114 1.0E-06
sp|P80579|THIO_ALIAC Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 27 125 2.0E-06
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 39 103 2.0E-06
sp|O17486|THIO_ECHGR Thioredoxin OS=Echinococcus granulosus GN=TRX PE=3 SV=2 41 104 2.0E-06
sp|P47370|THIO_MYCGE Thioredoxin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxA PE=3 SV=1 28 107 2.0E-06
sp|Q8L7S9|TRXY2_ARATH Thioredoxin Y2, chloroplastic OS=Arabidopsis thaliana GN=At1g43560 PE=2 SV=1 28 104 2.0E-06
sp|Q4UNK3|THIO_RICFE Thioredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxA PE=3 SV=2 25 121 2.0E-06
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 379 466 2.0E-06
sp|Q9XFH8|TRXF1_ARATH Thioredoxin F1, chloroplastic OS=Arabidopsis thaliana GN=At3g02730 PE=1 SV=2 13 129 2.0E-06
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 359 444 3.0E-06
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 359 444 3.0E-06
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 367 466 3.0E-06
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 41 104 3.0E-06
sp|O51890|THIO_BUCAP Thioredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trxA PE=3 SV=1 366 468 3.0E-06
sp|Q8H2V6|CITRX_ORYSJ Thioredoxin-like protein CITRX, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0378900 PE=2 SV=1 21 103 3.0E-06
sp|O81332|TRXF_MESCR Thioredoxin F-type, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1 24 116 3.0E-06
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 24 104 4.0E-06
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 367 444 4.0E-06
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 363 444 4.0E-06
sp|Q9ZEE0|THIO_RICPR Thioredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=trxA PE=3 SV=2 24 121 4.0E-06
sp|Q9LKW0|CITRX_SOLLC Thioredoxin-like protein CITRX, chloroplastic OS=Solanum lycopersicum GN=CITRX PE=1 SV=1 21 100 4.0E-06
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 31 100 4.0E-06
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 31 100 4.0E-06
sp|Q9R6P9|THIO_MYCGA Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 35 104 5.0E-06
sp|P10599|THIO_HUMAN Thioredoxin OS=Homo sapiens GN=TXN PE=1 SV=3 24 117 5.0E-06
sp|Q9DGI3|THIO_ICTPU Thioredoxin OS=Ictalurus punctatus GN=txn PE=3 SV=1 24 124 5.0E-06
sp|M1A3D5|CITRX_SOLTU Thioredoxin-like protein CITRX, chloroplastic OS=Solanum tuberosum GN=CITRX PE=3 SV=1 21 100 5.0E-06
sp|P52227|THIO_CHLCV Thioredoxin OS=Chlamydophila caviae (strain GPIC) GN=trxA PE=3 SV=1 24 121 5.0E-06
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 360 444 6.0E-06
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 24 104 7.0E-06
sp|Q9M7X9|CITRX_ARATH Thioredoxin-like protein CITRX, chloroplastic OS=Arabidopsis thaliana GN=CITRX PE=1 SV=1 21 100 7.0E-06
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 40 105 8.0E-06
sp|Q7KQL8|THIO_PLAF7 Thioredoxin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0545 PE=1 SV=1 32 128 8.0E-06
sp|P09856|TRXF_SPIOL Thioredoxin F-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 24 104 8.0E-06
sp|Q9XFH9|TRXF2_ARATH Thioredoxin F2, chloroplastic OS=Arabidopsis thaliana GN=At5g16400 PE=2 SV=1 17 129 8.0E-06
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 39 114 9.0E-06
sp|P52227|THIO_CHLCV Thioredoxin OS=Chlamydophila caviae (strain GPIC) GN=trxA PE=3 SV=1 360 444 9.0E-06
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 358 455 1.0E-05
sp|Q9RD25|THIO2_STRCO Putative thioredoxin-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxC PE=2 SV=1 26 104 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3155
MYQKSLVLGLATALVGVAMADSDVHQLTTKTFKDFISSNKDNLVLAKFYAPWCGHCKALAPEFEVAATSLKEKQI
KLVKIDCTEEADLCQEHGVEGYPTLKIFQGIENVSPYNGQRKADSIHSHMVKRSMPAVSILAKDTLEDFKTADKV
VVIAYIAADDKASNETFTTLANNLRDEYMFGGVNDDALAEAEGVKFPSVVLYKSFDEGKNNFEGKFEAEALEKFI
KTSATPLVGEVGPETYAGYMSAGIPLGYIFAETPEERESLAKALKPVAEKHKGKVNFATIDAKQFGAHAGNLNLK
TDKFPCFAIQDTGNNKKYPFDQEKEVNHDNIAKFVGDYVAGKVEASIKSEPIPEKQEGAVTVVVAKNYEQIIMDD
TKDVLLEFYAPWCGHCKALAPKYEQLAAQYAESEYKDKIVIAKVDATANDVPDDVAGFPTIKLFPAGAKDAPITY
SGSRTVEDLVTFIKENGKYKAGISIKAEGTDEAAPAATDKDKAEAKKDKADAKKDKEADEAKEDHDEL
Coding >Ophio5|3155
ATGTATCAGAAGAGCCTTGTTCTCGGCCTCGCGACTGCCCTCGTCGGCGTCGCCATGGCCGACTCTGACGTCCAC
CAGCTGACGACCAAGACGTTCAAAGACTTCATTTCCAGCAACAAGGATAACCTCGTCTTGGCCAAGTTCTACGCT
CCCTGGTGTGGCCACTGCAAGGCCCTCGCCCCGGAGTTTGAGGTGGCCGCCACCTCGCTCAAGGAGAAGCAGATC
AAGCTGGTCAAGATCGACTGCACTGAGGAGGCCGATCTCTGCCAGGAGCACGGCGTCGAGGGCTATCCTACCCTC
AAGATTTTCCAAGGTATAGAAAACGTCTCGCCATACAATGGCCAGCGCAAGGCTGACAGCATCCACTCTCACATG
GTCAAGCGTTCTATGCCTGCCGTCTCCATCCTCGCCAAGGATACCCTCGAGGACTTCAAGACGGCTGATAAGGTT
GTCGTGATTGCCTACATTGCCGCCGACGACAAGGCATCTAACGAGACCTTCACCACCCTTGCCAACAACCTGCGG
GATGAATACATGTTCGGAGGTGTCAATGACGACGCCCTTGCCGAGGCCGAGGGCGTCAAGTTCCCCTCCGTCGTT
CTCTACAAGTCCTTTGACGAGGGTAAGAACAACTTCGAAGGAAAGTTTGAGGCCGAGGCCCTCGAGAAGTTCATC
AAGACGTCTGCTACGCCTCTGGTCGGTGAAGTCGGCCCGGAGACGTATGCCGGCTACATGTCTGCCGGTATCCCA
CTTGGCTACATTTTCGCCGAGACGCCAGAGGAGCGCGAATCCCTGGCCAAGGCTCTGAAGCCCGTCGCCGAGAAG
CACAAGGGCAAGGTCAACTTTGCTACCATCGATGCCAAGCAGTTCGGCGCCCACGCCGGCAACCTCAACCTCAAG
ACCGACAAGTTCCCATGCTTCGCCATCCAGGACACCGGCAACAACAAGAAGTATCCCTTCGACCAAGAGAAGGAG
GTTAACCACGACAATATTGCCAAGTTCGTCGGCGATTACGTCGCCGGCAAGGTCGAGGCCAGCATCAAGTCCGAG
CCCATCCCGGAGAAGCAGGAAGGTGCCGTCACCGTCGTCGTCGCCAAGAACTACGAGCAGATCATTATGGATGAC
ACCAAGGACGTGCTGCTTGAATTCTACGCCCCTTGGTGCGGCCACTGCAAGGCTCTGGCTCCCAAGTATGAGCAA
CTGGCGGCCCAGTACGCCGAGAGCGAATACAAGGACAAAATTGTCATCGCAAAGGTCGACGCCACCGCCAACGAC
GTTCCCGACGACGTCGCCGGTTTCCCCACCATTAAGCTGTTCCCCGCCGGCGCAAAGGACGCGCCCATCACCTAC
AGCGGCTCCCGCACCGTTGAGGACCTCGTCACCTTCATCAAAGAGAACGGAAAGTACAAGGCCGGCATCTCCATC
AAGGCCGAGGGCACCGACGAGGCCGCCCCTGCCGCGACCGACAAGGACAAGGCTGAGGCCAAGAAGGACAAGGCC
GATGCCAAGAAGGACAAGGAGGCCGACGAGGCCAAGGAGGACCACGACGAGCTG
Transcript >Ophio5|3155
ATGTATCAGAAGAGCCTTGTTCTCGGCCTCGCGACTGCCCTCGTCGGCGTCGCCATGGCCGACTCTGACGTCCAC
CAGCTGACGACCAAGACGTTCAAAGACTTCATTTCCAGCAACAAGGATAACCTCGTCTTGGCCAAGTTCTACGCT
CCCTGGTGTGGCCACTGCAAGGCCCTCGCCCCGGAGTTTGAGGTGGCCGCCACCTCGCTCAAGGAGAAGCAGATC
AAGCTGGTCAAGATCGACTGCACTGAGGAGGCCGATCTCTGCCAGGAGCACGGCGTCGAGGGCTATCCTACCCTC
AAGATTTTCCAAGGTATAGAAAACGTCTCGCCATACAATGGCCAGCGCAAGGCTGACAGCATCCACTCTCACATG
GTCAAGCGTTCTATGCCTGCCGTCTCCATCCTCGCCAAGGATACCCTCGAGGACTTCAAGACGGCTGATAAGGTT
GTCGTGATTGCCTACATTGCCGCCGACGACAAGGCATCTAACGAGACCTTCACCACCCTTGCCAACAACCTGCGG
GATGAATACATGTTCGGAGGTGTCAATGACGACGCCCTTGCCGAGGCCGAGGGCGTCAAGTTCCCCTCCGTCGTT
CTCTACAAGTCCTTTGACGAGGGTAAGAACAACTTCGAAGGAAAGTTTGAGGCCGAGGCCCTCGAGAAGTTCATC
AAGACGTCTGCTACGCCTCTGGTCGGTGAAGTCGGCCCGGAGACGTATGCCGGCTACATGTCTGCCGGTATCCCA
CTTGGCTACATTTTCGCCGAGACGCCAGAGGAGCGCGAATCCCTGGCCAAGGCTCTGAAGCCCGTCGCCGAGAAG
CACAAGGGCAAGGTCAACTTTGCTACCATCGATGCCAAGCAGTTCGGCGCCCACGCCGGCAACCTCAACCTCAAG
ACCGACAAGTTCCCATGCTTCGCCATCCAGGACACCGGCAACAACAAGAAGTATCCCTTCGACCAAGAGAAGGAG
GTTAACCACGACAATATTGCCAAGTTCGTCGGCGATTACGTCGCCGGCAAGGTCGAGGCCAGCATCAAGTCCGAG
CCCATCCCGGAGAAGCAGGAAGGTGCCGTCACCGTCGTCGTCGCCAAGAACTACGAGCAGATCATTATGGATGAC
ACCAAGGACGTGCTGCTTGAATTCTACGCCCCTTGGTGCGGCCACTGCAAGGCTCTGGCTCCCAAGTATGAGCAA
CTGGCGGCCCAGTACGCCGAGAGCGAATACAAGGACAAAATTGTCATCGCAAAGGTCGACGCCACCGCCAACGAC
GTTCCCGACGACGTCGCCGGTTTCCCCACCATTAAGCTGTTCCCCGCCGGCGCAAAGGACGCGCCCATCACCTAC
AGCGGCTCCCGCACCGTTGAGGACCTCGTCACCTTCATCAAAGAGAACGGAAAGTACAAGGCCGGCATCTCCATC
AAGGCCGAGGGCACCGACGAGGCCGCCCCTGCCGCGACCGACAAGGACAAGGCTGAGGCCAAGAAGGACAAGGCC
GATGCCAAGAAGGACAAGGAGGCCGACGAGGCCAAGGAGGACCACGACGAGCTGTAG
Gene >Ophio5|3155
ATGTATCAGAAGAGCCTTGTTCTCGGCCTCGCGACTGCCCTCGTCGGCGTCGCCATGGCCGACTCTGACGTCCAC
CAGCTGACGACCAAGACGTTCAAAGACTTCATTTCCAGCAACAAGGATAACCTCGTCTTGGCCAAGTGTACGTTG
TTGTGCTGCCCTGTTTGCTTTCGCTTCCTGACGAACCTGGCCGCAGTCTACGCTCCCTGGTGTGGCCACTGCAAG
GCCCTCGCCCCGGAGTTTGAGGTGGCCGCCACCTCGCTCAAGGAGAAGCAGATCAAGCTGGTCAAGATCGACTGC
ACTGAGGAGGCCGATCTCTGCCAGGAGCACGGCGTCGAGGGCTATCCTACCCTCAAGATTTTCCAAGGTATAGAA
AACGTCTCGCCATACAATGGCCAGCGCAAGGCTGACAGGTACACTCTCCCCTTTGTCGTCCCACACCACAATGGC
TGACCATCCACCCTACAGCATCCACTCTCACATGGTCAAGCGTTCTATGCCTGCCGTCTCCATCCTCGCCAAGGA
TACCCTCGAGGACTTCAAGACGGCTGATAAGGTTGTCGTGATTGCCTACATTGCCGCCGACGACAAGGCATCTAA
CGAGACCTTCACCACCCTTGCCAACAACCTGCGGGATGAATACATGTTCGGAGGTGTCAATGACGACGCCCTTGC
CGAGGCCGAGGGCGTCAAGTTCCCCTCCGTCGTTCTCTACAAGTCCTTTGACGAGGGTAAGAACAACTTCGAAGG
AAAGTTTGAGGCCGAGGCCCTCGAGAAGTTCATCAAGACGTCTGCTACGCCTCTGGTCGGTGAAGTCGGCCCGGA
GACGTATGCCGGCTACATGTCTGCCGGTATCCCACTTGGCTACATTTTCGCCGAGACGCCAGAGGAGCGCGAATC
CCTGGCCAAGGCTCTGAAGCCCGTCGCCGAGAAGCACAAGGGCAAGGTCAACTTTGCTACCATCGATGCCAAGCA
GTTCGGCGCCCACGCCGGCAACCTCAACCTCAAGACCGACAAGTTCCCATGCTTCGCCATCCAGGACACCGGCAA
CAACAAGAAGTATCCCTTCGACCAAGAGAAGGAGGTTAACCACGACAATATTGCCAAGTTCGTCGGCGATTACGT
CGCCGGCAAGGTCGAGGCCAGCATCAAGTCCGAGCCCATCCCGGAGAAGCAGGAAGGTGCCGTCACCGTCGTCGT
CGCCAAGAACTACGAGCAGATCATTATGGATGACACCAAGGACGTGCTGCTTGAATTCTACGCCCCTTGGTGCGG
CCACTGCAAGGCTCTGGCTCCCAAGTATGAGCAACTGGCGGCCCAGTACGCCGAGAGCGAATACAAGGACAAAAT
TGTCATCGCAAAGGTCGACGCCACCGCCAACGACGTTCCCGACGACGTCGCCGGTTTCCCCACCATTAAGCTGTT
CCCCGCCGGCGCAAAGGACGCGCCCATCACCTACAGCGGCTCCCGCACCGTTGAGGACCTCGTCACCTTCATCAA
AGAGAACGGAAAGTACAAGGCCGGCATCTCCATCAAGGCCGAGGGCACCGACGAGGCCGCCCCTGCCGCGACCGA
CAAGGACAAGGCTGAGGCCAAGAAGGACAAGGCCGATGCCAAGAAGGACAAGGAGGCCGACGAGGCCAAGGAGGA
CCACGACGAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail