Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3149
Gene name
Locationscaffold_25:40447..41644
Strand+
Gene length (bp)1197
Transcript length (bp)1197
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 6.2E-30 142 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 124 334 2.0E-26
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 124 334 2.0E-26
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 126 355 3.0E-25
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 126 355 3.0E-25
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 126 355 4.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 124 334 2.0E-26
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 124 334 2.0E-26
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 126 355 3.0E-25
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 126 355 3.0E-25
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 126 355 4.0E-25
sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 126 353 9.0E-25
sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 126 355 2.0E-24
sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 126 355 2.0E-24
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 47 315 6.0E-23
sp|O42815|FAEA_ASPTU Feruloyl esterase A OS=Aspergillus tubingensis GN=faeA PE=3 SV=1 126 341 4.0E-21
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 105 307 5.0E-20
sp|P47145|YJ77_YEAST Putative lipase YJR107W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR107W PE=3 SV=2 56 371 5.0E-17
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 64 323 3.0E-15
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 64 323 3.0E-15
sp|A2ZW16|PLA1_ORYSJ Phospholipase A1-II 1 OS=Oryza sativa subsp. japonica GN=Os01g0651100 PE=3 SV=2 139 308 4.0E-06
sp|A2WT95|PLA1_ORYSI Phospholipase A1-II 1 OS=Oryza sativa subsp. indica GN=OsI_03083 PE=3 SV=2 139 308 4.0E-06
sp|A2WT96|PLA2_ORYSI Phospholipase A1-II 2 OS=Oryza sativa subsp. indica GN=OsI_03084 PE=3 SV=2 117 293 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3149
MCSLVTRSRARQRPVSSASATALTIPRRHVPTLNHDTLPLFAIAVIMRLAWTLVGPVVLASSSGPVAASIPTPLF
GDLERLSRIADIAYCVGNSGVRKPFHCLSHCSDFPELSLVTSWHTGLLLGDSCGYIALDRAGPDILVVFRGTYSV
TNTIADLSTVPQPYMPYPGPDGGRPGLECTNCSVHTGFFQSWRSARRLVLPELEALKAEYPTAAVQLVGHSLGGA
VACLAALELKVSLGWHDVRVSTFGEPRLGNDGLARFVDSVFHLDRGLDVASWSYRRVTHVDDPVPLLPWDEWGYS
SHAGEIYISKPDLAPTEYDLRPCVGDGDAECSTGARRAVRQTLPRHHLVRRGADTTLLGPWPPLFAHRDYFWRLG
LCVPGGDPANWGRSPASPMPDEL
Coding >Ophio5|3149
ATGTGCAGCCTCGTCACACGGTCACGCGCCCGACAGCGCCCCGTCTCGTCCGCCTCTGCCACGGCACTGACGATA
CCCCGACGACATGTCCCGACTCTCAACCATGACACCCTCCCCCTGTTCGCAATTGCCGTCATAATGAGGCTGGCC
TGGACTCTCGTCGGCCCGGTCGTCCTAGCTTCTTCGTCCGGTCCCGTCGCCGCGTCCATCCCTACGCCCCTGTTC
GGCGACCTCGAGCGGCTGTCGCGCATCGCCGACATAGCCTACTGCGTCGGTAACTCGGGCGTGCGCAAGCCCTTC
CACTGCCTCTCCCACTGCAGCGACTTCCCGGAGCTCTCGCTGGTGACGTCGTGGCACACGGGCCTGCTCCTGGGC
GACAGCTGCGGCTACATCGCCTTGGACCGCGCCGGGCCGGATATCCTCGTCGTCTTCCGCGGCACCTACAGCGTC
ACCAACACAATCGCCGACCTGAGTACCGTCCCGCAACCCTACATGCCCTACCCGGGCCCCGACGGCGGTCGGCCC
GGGCTGGAATGCACAAACTGCTCCGTCCACACCGGTTTCTTCCAGTCGTGGCGCAGCGCGAGGCGCCTCGTCCTT
CCGGAGCTCGAGGCGCTCAAGGCCGAGTATCCGACGGCGGCCGTCCAGCTTGTGGGACACAGCCTCGGCGGCGCC
GTGGCCTGCCTCGCGGCGCTGGAGCTCAAGGTGTCGCTGGGCTGGCACGACGTCAGGGTCAGCACCTTTGGCGAG
CCTCGTCTGGGCAACGACGGCCTGGCGCGCTTCGTCGACTCCGTCTTCCATCTCGATAGAGGCCTGGACGTCGCG
TCGTGGTCGTACCGGCGCGTGACGCACGTCGACGACCCCGTGCCCCTTCTCCCGTGGGACGAATGGGGTTACAGC
TCGCACGCGGGCGAGATATACATCTCCAAGCCGGACCTAGCCCCGACCGAGTACGACTTGCGGCCTTGCGTCGGC
GACGGCGACGCCGAGTGCAGCACAGGCGCCCGGCGAGCCGTCCGGCAAACACTGCCTCGGCATCATCTCGTCCGT
CGCGGGGCGGACACGACGCTGCTCGGACCGTGGCCCCCGCTGTTCGCCCATCGGGATTACTTCTGGAGGCTGGGA
CTCTGCGTGCCCGGCGGCGACCCGGCCAATTGGGGGAGGAGTCCGGCCAGTCCGATGCCCGACGAGCTG
Transcript >Ophio5|3149
ATGTGCAGCCTCGTCACACGGTCACGCGCCCGACAGCGCCCCGTCTCGTCCGCCTCTGCCACGGCACTGACGATA
CCCCGACGACATGTCCCGACTCTCAACCATGACACCCTCCCCCTGTTCGCAATTGCCGTCATAATGAGGCTGGCC
TGGACTCTCGTCGGCCCGGTCGTCCTAGCTTCTTCGTCCGGTCCCGTCGCCGCGTCCATCCCTACGCCCCTGTTC
GGCGACCTCGAGCGGCTGTCGCGCATCGCCGACATAGCCTACTGCGTCGGTAACTCGGGCGTGCGCAAGCCCTTC
CACTGCCTCTCCCACTGCAGCGACTTCCCGGAGCTCTCGCTGGTGACGTCGTGGCACACGGGCCTGCTCCTGGGC
GACAGCTGCGGCTACATCGCCTTGGACCGCGCCGGGCCGGATATCCTCGTCGTCTTCCGCGGCACCTACAGCGTC
ACCAACACAATCGCCGACCTGAGTACCGTCCCGCAACCCTACATGCCCTACCCGGGCCCCGACGGCGGTCGGCCC
GGGCTGGAATGCACAAACTGCTCCGTCCACACCGGTTTCTTCCAGTCGTGGCGCAGCGCGAGGCGCCTCGTCCTT
CCGGAGCTCGAGGCGCTCAAGGCCGAGTATCCGACGGCGGCCGTCCAGCTTGTGGGACACAGCCTCGGCGGCGCC
GTGGCCTGCCTCGCGGCGCTGGAGCTCAAGGTGTCGCTGGGCTGGCACGACGTCAGGGTCAGCACCTTTGGCGAG
CCTCGTCTGGGCAACGACGGCCTGGCGCGCTTCGTCGACTCCGTCTTCCATCTCGATAGAGGCCTGGACGTCGCG
TCGTGGTCGTACCGGCGCGTGACGCACGTCGACGACCCCGTGCCCCTTCTCCCGTGGGACGAATGGGGTTACAGC
TCGCACGCGGGCGAGATATACATCTCCAAGCCGGACCTAGCCCCGACCGAGTACGACTTGCGGCCTTGCGTCGGC
GACGGCGACGCCGAGTGCAGCACAGGCGCCCGGCGAGCCGTCCGGCAAACACTGCCTCGGCATCATCTCGTCCGT
CGCGGGGCGGACACGACGCTGCTCGGACCGTGGCCCCCGCTGTTCGCCCATCGGGATTACTTCTGGAGGCTGGGA
CTCTGCGTGCCCGGCGGCGACCCGGCCAATTGGGGGAGGAGTCCGGCCAGTCCGATGCCCGACGAGCTGTAG
Gene >Ophio5|3149
ATGTGCAGCCTCGTCACACGGTCACGCGCCCGACAGCGCCCCGTCTCGTCCGCCTCTGCCACGGCACTGACGATA
CCCCGACGACATGTCCCGACTCTCAACCATGACACCCTCCCCCTGTTCGCAATTGCCGTCATAATGAGGCTGGCC
TGGACTCTCGTCGGCCCGGTCGTCCTAGCTTCTTCGTCCGGTCCCGTCGCCGCGTCCATCCCTACGCCCCTGTTC
GGCGACCTCGAGCGGCTGTCGCGCATCGCCGACATAGCCTACTGCGTCGGTAACTCGGGCGTGCGCAAGCCCTTC
CACTGCCTCTCCCACTGCAGCGACTTCCCGGAGCTCTCGCTGGTGACGTCGTGGCACACGGGCCTGCTCCTGGGC
GACAGCTGCGGCTACATCGCCTTGGACCGCGCCGGGCCGGATATCCTCGTCGTCTTCCGCGGCACCTACAGCGTC
ACCAACACAATCGCCGACCTGAGTACCGTCCCGCAACCCTACATGCCCTACCCGGGCCCCGACGGCGGTCGGCCC
GGGCTGGAATGCACAAACTGCTCCGTCCACACCGGTTTCTTCCAGTCGTGGCGCAGCGCGAGGCGCCTCGTCCTT
CCGGAGCTCGAGGCGCTCAAGGCCGAGTATCCGACGGCGGCCGTCCAGCTTGTGGGACACAGCCTCGGCGGCGCC
GTGGCCTGCCTCGCGGCGCTGGAGCTCAAGGTGTCGCTGGGCTGGCACGACGTCAGGGTCAGCACCTTTGGCGAG
CCTCGTCTGGGCAACGACGGCCTGGCGCGCTTCGTCGACTCCGTCTTCCATCTCGATAGAGGCCTGGACGTCGCG
TCGTGGTCGTACCGGCGCGTGACGCACGTCGACGACCCCGTGCCCCTTCTCCCGTGGGACGAATGGGGTTACAGC
TCGCACGCGGGCGAGATATACATCTCCAAGCCGGACCTAGCCCCGACCGAGTACGACTTGCGGCCTTGCGTCGGC
GACGGCGACGCCGAGTGCAGCACAGGCGCCCGGCGAGCCGTCCGGCAAACACTGCCTCGGCATCATCTCGTCCGT
CGCGGGGCGGACACGACGCTGCTCGGACCGTGGCCCCCGCTGTTCGCCCATCGGGATTACTTCTGGAGGCTGGGA
CTCTGCGTGCCCGGCGGCGACCCGGCCAATTGGGGGAGGAGTCCGGCCAGTCCGATGCCCGACGAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail