Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3141
Gene name
Locationscaffold_25:25433..28539
Strand-
Gene length (bp)3106
Transcript length (bp)2799
Coding sequence length (bp)2796
Protein length (aa) 932

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00621 RhoGEF RhoGEF domain 3.4E-21 236 482

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q69ZK0|PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus GN=Prex1 PE=1 SV=2 227 482 2.0E-07
sp|Q8TCU6|PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens GN=PREX1 PE=1 SV=3 227 482 3.0E-07

GO

GO Term Description Terminal node
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0003674 molecular_function No
GO:0030234 enzyme regulator activity No
GO:0098772 molecular function regulator activity No
GO:0030695 GTPase regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3141
MSVNSPEPSSLPGSRRCSVGDESEDEQDVACEDHNQPANIDQDAATSELDKLHIQGIETLDTSRSIENIGDTLRA
PGNPVSPLPLASVEENSENPAQGSPRGSESRPVRPFHKWVRSFHRKARRRPSVLAANSEPLSRGQAEDVLPSPPM
SRMSSSSDSSFRFVAAVRSASVSLASASIVTRSRRNTALSRCMSRTERSSRASASVPRASEESAILDKTDVVDLA
ATERSMQRRRILEELISTEEGYIGDVRFLMNVYVTILASLPAMCMGLRSSINKNLTDIVELHEEILGELHRAVPH
SEYTQPQAPSGSYSMANWAAAETPPGHHRWASVDGALERRRRVSWLQKTPGMLADPQVVAEVSKIFAKKMNRFFI
YKEYGAKYELMIKDVASANQAMPQWETYQKGLETLASILGCAKNAPDQCKKALKMGDLLVKPIQRICRYPLLFAE
LLKYTPVSDCPNSHMEVDSVLMRLREANSEINRATDDSTIKATLERTWILQDRLVFPHRKLDSASKNRLRSFGHI
RLCGTLHVCWQSHRGVDGQYLICLLYRDVLCLASAGKADPLYMIQACVNLNRASVEDVDNGRGLQCHTAPFSWKL
VFECDHQLYEMIMTACTPKEEMEWRTRLSRRAKDGSEPREPSVFSSLDLDIKSLGTVFGKPGTIARRISIHRATT
VGPKSPLCQVVLKNTSVVRDTGNSASAALTINRSQSVLTTQARMPVLAPSRSERARLEALLADVWTRETLPFPGM
TTRARSEHLVRTSASTVMRKLSVTSIASSFARRSSSLTQKAKTCDEPSGRGDVKRRGFKSSTDELWADGKSADAE
TLRRLKRPRTGHVLAADETKPESSPVNISGAARVAIPVGGQGAVSTLRTSSANSQRVVRGKKSGSQHADKENKCG
RAGDEVWSPGRKGKVAGGKTDEGSIGLKSYFR
Coding >Ophio5|3141
ATGTCCGTCAACTCACCCGAACCGTCTTCTTTACCCGGATCTCGACGATGCAGCGTAGGAGACGAATCGGAAGAT
GAGCAAGACGTCGCTTGTGAAGACCACAACCAGCCGGCCAACATCGATCAGGACGCTGCCACCTCGGAACTCGAC
AAGCTGCACATTCAAGGCATCGAGACTCTCGACACATCGCGCAGCATCGAGAACATCGGTGACACGCTCCGGGCG
CCCGGGAATCCTGTTTCCCCTCTGCCTCTCGCATCCGTCGAGGAGAACTCGGAAAATCCAGCTCAAGGTTCCCCG
CGAGGCAGCGAGTCTCGCCCTGTCCGGCCCTTTCACAAATGGGTTCGATCCTTCCACCGAAAAGCGAGACGCCGG
CCCTCCGTGTTGGCAGCCAACAGTGAACCTCTGTCTCGAGGGCAGGCAGAGGACGTCTTGCCAAGTCCGCCGATG
AGTCGAATGTCCTCATCCTCCGACTCGTCCTTTAGGTTTGTCGCGGCTGTCCGAAGCGCTAGTGTCAGCCTCGCC
AGCGCCAGCATCGTGACGCGATCCAGGAGGAACACGGCGCTCTCGCGGTGCATGTCCCGAACGGAGCGCAGCAGT
AGGGCCTCTGCTTCGGTACCCAGAGCGTCGGAAGAGAGTGCCATACTTGACAAGACGGACGTGGTTGACCTTGCC
GCCACAGAGCGTTCCATGCAGCGACGACGCATCCTAGAGGAGCTCATCAGCACCGAAGAGGGCTATATCGGTGAT
GTGCGCTTTCTCATGAACGTCTATGTCACTATTCTCGCCTCTCTCCCGGCCATGTGCATGGGTCTGCGGTCTTCT
ATCAATAAGAATTTGACCGACATTGTCGAGCTGCACGAGGAGATTCTAGGTGAGCTACACCGAGCGGTGCCTCAT
TCCGAATACACACAGCCTCAGGCGCCGTCGGGGTCTTACAGCATGGCAAACTGGGCCGCGGCCGAGACGCCTCCT
GGCCACCATCGATGGGCCAGCGTCGATGGAGCTCTTGAGCGCCGCAGACGCGTGAGCTGGTTGCAGAAGACTCCC
GGCATGCTAGCCGACCCGCAGGTCGTGGCAGAAGTGTCCAAGATCTTTGCCAAAAAGATGAACCGGTTCTTCATA
TATAAGGAGTATGGAGCAAAGTATGAGTTGATGATCAAGGACGTTGCGTCGGCCAACCAGGCCATGCCGCAGTGG
GAGACATACCAAAAGGGCCTGGAGACGCTTGCGTCCATTCTCGGCTGCGCAAAGAATGCCCCAGACCAATGCAAA
AAGGCGCTCAAGATGGGGGATCTACTCGTCAAGCCCATTCAGAGGATCTGCAGATATCCGCTTCTCTTTGCAGAG
CTCCTCAAGTACACGCCCGTGTCGGATTGCCCCAACTCCCATATGGAGGTTGACAGCGTTTTGATGAGGCTGCGG
GAGGCCAATTCTGAGATCAATCGAGCTACCGACGATTCGACCATCAAAGCCACGCTGGAGAGGACTTGGATTTTA
CAAGACCGACTGGTGTTCCCCCACAGGAAACTCGACTCAGCGTCCAAGAACCGGTTGCGCTCCTTCGGCCACATC
CGCCTCTGCGGCACGCTGCACGTCTGCTGGCAATCGCACAGAGGAGTGGACGGGCAGTACTTGATCTGCCTCCTC
TACCGCGACGTCCTGTGCCTCGCCTCGGCCGGCAAGGCAGATCCACTATACATGATCCAGGCCTGTGTCAACTTG
AACAGAGCCAGCGTTGAGGACGTCGACAACGGGCGAGGTCTTCAGTGCCATACGGCGCCCTTTTCCTGGAAGCTG
GTGTTTGAATGTGATCATCAGCTGTACGAGATGATCATGACGGCCTGCACGCCCAAGGAGGAGATGGAATGGCGA
ACAAGGCTTAGCCGTCGGGCCAAGGACGGCTCCGAGCCAAGGGAGCCCAGCGTCTTTAGCTCTCTAGATCTGGAC
ATCAAGAGTCTCGGCACCGTGTTTGGGAAGCCAGGGACCATTGCTCGGCGCATCTCGATACACCGAGCGACGACG
GTGGGGCCGAAATCACCCCTGTGCCAAGTCGTGCTCAAGAACACGAGCGTCGTCCGGGACACGGGCAACAGCGCC
TCGGCAGCACTGACCATCAATCGGTCTCAGTCTGTGCTCACGACGCAGGCGCGGATGCCTGTGCTCGCGCCGTCG
CGTAGCGAGCGGGCACGATTGGAGGCGTTGCTGGCCGACGTTTGGACGCGAGAGACCTTGCCCTTCCCCGGTATG
ACGACGCGGGCGCGGAGCGAGCACCTCGTCCGGACGTCGGCATCGACGGTGATGAGAAAGCTCAGTGTTACAAGC
ATCGCCAGCTCTTTCGCTCGAAGATCCAGCAGCCTCACGCAGAAAGCGAAGACGTGCGATGAGCCGTCGGGAAGA
GGGGACGTCAAGCGCCGGGGCTTCAAGAGCTCGACGGACGAGCTCTGGGCGGACGGCAAGAGTGCGGACGCGGAA
ACGCTTCGCAGATTGAAGAGGCCTCGGACAGGTCATGTGCTGGCTGCCGACGAGACAAAACCAGAGTCATCCCCG
GTGAATATTTCTGGCGCAGCAAGGGTCGCCATACCAGTAGGAGGACAAGGCGCAGTCAGTACGCTGCGGACGTCG
TCGGCCAATAGCCAGCGAGTTGTCCGAGGCAAAAAGTCTGGCTCACAGCACGCGGACAAGGAGAACAAGTGCGGA
AGAGCCGGCGACGAGGTTTGGAGCCCGGGGCGGAAGGGAAAAGTCGCCGGCGGCAAGACGGACGAGGGCAGCATC
GGGCTGAAGAGCTATTTTCGA
Transcript >Ophio5|3141
ATGTCCGTCAACTCACCCGAACCGTCTTCTTTACCCGGATCTCGACGATGCAGCGTAGGAGACGAATCGGAAGAT
GAGCAAGACGTCGCTTGTGAAGACCACAACCAGCCGGCCAACATCGATCAGGACGCTGCCACCTCGGAACTCGAC
AAGCTGCACATTCAAGGCATCGAGACTCTCGACACATCGCGCAGCATCGAGAACATCGGTGACACGCTCCGGGCG
CCCGGGAATCCTGTTTCCCCTCTGCCTCTCGCATCCGTCGAGGAGAACTCGGAAAATCCAGCTCAAGGTTCCCCG
CGAGGCAGCGAGTCTCGCCCTGTCCGGCCCTTTCACAAATGGGTTCGATCCTTCCACCGAAAAGCGAGACGCCGG
CCCTCCGTGTTGGCAGCCAACAGTGAACCTCTGTCTCGAGGGCAGGCAGAGGACGTCTTGCCAAGTCCGCCGATG
AGTCGAATGTCCTCATCCTCCGACTCGTCCTTTAGGTTTGTCGCGGCTGTCCGAAGCGCTAGTGTCAGCCTCGCC
AGCGCCAGCATCGTGACGCGATCCAGGAGGAACACGGCGCTCTCGCGGTGCATGTCCCGAACGGAGCGCAGCAGT
AGGGCCTCTGCTTCGGTACCCAGAGCGTCGGAAGAGAGTGCCATACTTGACAAGACGGACGTGGTTGACCTTGCC
GCCACAGAGCGTTCCATGCAGCGACGACGCATCCTAGAGGAGCTCATCAGCACCGAAGAGGGCTATATCGGTGAT
GTGCGCTTTCTCATGAACGTCTATGTCACTATTCTCGCCTCTCTCCCGGCCATGTGCATGGGTCTGCGGTCTTCT
ATCAATAAGAATTTGACCGACATTGTCGAGCTGCACGAGGAGATTCTAGGTGAGCTACACCGAGCGGTGCCTCAT
TCCGAATACACACAGCCTCAGGCGCCGTCGGGGTCTTACAGCATGGCAAACTGGGCCGCGGCCGAGACGCCTCCT
GGCCACCATCGATGGGCCAGCGTCGATGGAGCTCTTGAGCGCCGCAGACGCGTGAGCTGGTTGCAGAAGACTCCC
GGCATGCTAGCCGACCCGCAGGTCGTGGCAGAAGTGTCCAAGATCTTTGCCAAAAAGATGAACCGGTTCTTCATA
TATAAGGAGTATGGAGCAAAGTATGAGTTGATGATCAAGGACGTTGCGTCGGCCAACCAGGCCATGCCGCAGTGG
GAGACATACCAAAAGGGCCTGGAGACGCTTGCGTCCATTCTCGGCTGCGCAAAGAATGCCCCAGACCAATGCAAA
AAGGCGCTCAAGATGGGGGATCTACTCGTCAAGCCCATTCAGAGGATCTGCAGATATCCGCTTCTCTTTGCAGAG
CTCCTCAAGTACACGCCCGTGTCGGATTGCCCCAACTCCCATATGGAGGTTGACAGCGTTTTGATGAGGCTGCGG
GAGGCCAATTCTGAGATCAATCGAGCTACCGACGATTCGACCATCAAAGCCACGCTGGAGAGGACTTGGATTTTA
CAAGACCGACTGGTGTTCCCCCACAGGAAACTCGACTCAGCGTCCAAGAACCGGTTGCGCTCCTTCGGCCACATC
CGCCTCTGCGGCACGCTGCACGTCTGCTGGCAATCGCACAGAGGAGTGGACGGGCAGTACTTGATCTGCCTCCTC
TACCGCGACGTCCTGTGCCTCGCCTCGGCCGGCAAGGCAGATCCACTATACATGATCCAGGCCTGTGTCAACTTG
AACAGAGCCAGCGTTGAGGACGTCGACAACGGGCGAGGTCTTCAGTGCCATACGGCGCCCTTTTCCTGGAAGCTG
GTGTTTGAATGTGATCATCAGCTGTACGAGATGATCATGACGGCCTGCACGCCCAAGGAGGAGATGGAATGGCGA
ACAAGGCTTAGCCGTCGGGCCAAGGACGGCTCCGAGCCAAGGGAGCCCAGCGTCTTTAGCTCTCTAGATCTGGAC
ATCAAGAGTCTCGGCACCGTGTTTGGGAAGCCAGGGACCATTGCTCGGCGCATCTCGATACACCGAGCGACGACG
GTGGGGCCGAAATCACCCCTGTGCCAAGTCGTGCTCAAGAACACGAGCGTCGTCCGGGACACGGGCAACAGCGCC
TCGGCAGCACTGACCATCAATCGGTCTCAGTCTGTGCTCACGACGCAGGCGCGGATGCCTGTGCTCGCGCCGTCG
CGTAGCGAGCGGGCACGATTGGAGGCGTTGCTGGCCGACGTTTGGACGCGAGAGACCTTGCCCTTCCCCGGTATG
ACGACGCGGGCGCGGAGCGAGCACCTCGTCCGGACGTCGGCATCGACGGTGATGAGAAAGCTCAGTGTTACAAGC
ATCGCCAGCTCTTTCGCTCGAAGATCCAGCAGCCTCACGCAGAAAGCGAAGACGTGCGATGAGCCGTCGGGAAGA
GGGGACGTCAAGCGCCGGGGCTTCAAGAGCTCGACGGACGAGCTCTGGGCGGACGGCAAGAGTGCGGACGCGGAA
ACGCTTCGCAGATTGAAGAGGCCTCGGACAGGTCATGTGCTGGCTGCCGACGAGACAAAACCAGAGTCATCCCCG
GTGAATATTTCTGGCGCAGCAAGGGTCGCCATACCAGTAGGAGGACAAGGCGCAGTCAGTACGCTGCGGACGTCG
TCGGCCAATAGCCAGCGAGTTGTCCGAGGCAAAAAGTCTGGCTCACAGCACGCGGACAAGGAGAACAAGTGCGGA
AGAGCCGGCGACGAGGTTTGGAGCCCGGGGCGGAAGGGAAAAGTCGCCGGCGGCAAGACGGACGAGGGCAGCATC
GGGCTGAAGAGCTATTTTCGATAG
Gene >Ophio5|3141
ATGTCCGTCAACTCACCCGAACCGTCTTCTTTACCCGGATCTCGACGATGCAGCGTAGGAGACGAATCGGAAGAT
GAGCAAGACGTCGCTTGTGAAGACCACAACCAGCCGGCCAACATCGATCAGGACGCTGCCACCTCGGAACTCGAC
AAGCTGCACATTCAAGGCATCGAGACTCTCGACACATCGCGCAGCATCGAGAACATCGGTGACACGCTCCGGGCG
CCCGGGAATCCTGTTTCCCCTCTGCCTCTCGCATCCGTCGAGGAGAACTCGGAAAATCCAGCTCAAGGTTCCCCG
CGAGGCAGCGAGTCTCGCCCTGTCCGGCCCTTTCACAAATGGGTTCGATCCTTCCACCGAAAAGCGAGACGCCGG
CCCTCCGTGTTGGCAGCCAACAGTGAACCTCTGTCTCGAGGGCAGGCAGAGGACGTCTTGCCAAGTCCGCCGATG
AGTCGAATGTCCTCATCCTCCGACTCGTCCTTTAGGTTTGTCGCGGCTGTCCGAAGCGCTAGTGTCAGCCTCGCC
AGCGCCAGCATCGTGACGCGATCCAGGAGGAACACGGCGCTCTCGCGGTGCATGTCCCGAACGGAGCGCAGCAGT
AGGGCCTCTGCTTCGGTACCCAGAGCGTCGGAAGAGAGTGCCATACTTGACAAGACGGACGTGGTTGACCTTGCC
GCCACAGAGCGTTCCATGCAGCGACGACGCATCCTAGAGGAGCTCATCAGCACCGAAGAGGGCTATATCGGTGAT
GTGCGCTTTCTCATGAACGTAAGTCACCAAGCGATTCGCTGCCATGTGAGGATTGCTCACCGTCGTCTAGGTCTA
TGTCACTATTCTCGCCTCTCTCCCGGCCATGTGCATGGGTCTGCGGTCTTCTATCAATAAGAATTTGACCGACAT
TGTCGAGCTGCACGAGGAGATTCTAGGTGAGCTACACCGAGCGGTGCCTCATTCCGAATACACACAGCCTCAGGC
GCCGTCGGGGTCTTACAGCATGGCAAACTGGGCCGCGGCCGAGACGCCTCCTGGCCACCATCGATGGGCCAGCGT
CGATGGAGCTCTTGAGCGCCGCAGACGCGTGAGCTGGTTGCAGAAGACTCCCGGCATGCTAGCCGACCCGCAGGT
CGTGGCAGAAGTGTCCAAGATCTTTGCCAAAAAGGTAGCATGTGCTATACCCCCTTGATTGCCGCAAGTGTTAAC
ATGACACCAGATGAACCGGTTCTTCATATATAAGGAGTATGGAGCAAAGTATGAGTTGATGATCAAGGACGTTGC
GTCGGCCAACCAGGCCATGCCGCAGTGGGAGACATACCAAAAGGGCCTGGAGACGCTTGCGTCCATTCTCGGCTG
CGCAAAGAATGCCCCAGACCAATGCAAAAAGGCGCTCAAGATGGGGGATCTACTCGTCAAGGTAAATTGCGCAGA
AACTCGTCGACTCACTTTACTAACCGGACGTGGCAGCCCATTCAGAGGATCTGCAGATATCCGCTTCTCTTTGCA
GAGCTCCTCAAGTACACGCCCGTGTCGGATTGCCCCAACTCCCATATGGAGGTTGACAGCGTTTTGATGAGGCTG
CGGGAGGCCAATTCTGAGATCAATCGAGCTACCGACGATTCGACCATCAAAGCCACGCTGGAGAGGACTTGGATT
TTACAAGACCGACTGGTGTTCCCCCACAGGGTATGTGCTCCGTCATCTCCCCACGACTGGATGGTAACTCGAACC
TCGATTGCAGAAACTCGACTCAGCGTCCAAGAACCGGTTGCGCTCCTTCGGCCACATCCGCCTCTGCGGCACGCT
GCACGTCTGCTGGCAATCGCACAGAGGAGTGGACGGGCAGTACTTGATCTGCCTCCTCTACCGCGACGTCCTGTG
CCTCGCCTCGGCCGGCAAGGCAGATCCACTATACATGATCCAGGCCTGTGTCAACTTGAACAGAGCCAGCGTTGA
GGACGTCGACAACGGGCGAGGTGAGTTACAGCATCTCCGTTGGGCGTCGATGACATGCTTATAGAGGAACAGGTC
TTCAGTGCCATACGGCGCCCTTTTCCTGGAAGCTGGTGTTTGAATGTGATCATCAGCTGTACGAGATGATCATGA
CGGCCTGCACGCCCAAGGAGGAGATGGAATGGCGAACAAGGCTTAGCCGTCGGGCCAAGGACGGCTCCGAGCCAA
GGGAGCCCAGCGTCTTTAGCTCTCTAGATCTGGACATCAAGAGTCTCGGCACCGTGTTTGGGAAGCCAGGTCAGT
TACCCCGGGCCAAGTGAGGAGCTTCATCTGACACGCCACAGGGACCATTGCTCGGCGCATCTCGATACACCGAGC
GACGACGGTGGGGCCGAAATCACCCCTGTGCCAAGTCGTGCTCAAGAACACGAGCGTCGTCCGGGACACGGGCAA
CAGCGCCTCGGCAGCACTGACCATCAATCGGTCTCAGTCTGTGCTCACGACGCAGGCGCGGATGCCTGTGCTCGC
GCCGTCGCGTAGCGAGCGGGCACGATTGGAGGCGTTGCTGGCCGACGTTTGGACGCGAGAGACCTTGCCCTTCCC
CGGTATGACGACGCGGGCGCGGAGCGAGCACCTCGTCCGGACGTCGGCATCGACGGTGATGAGAAAGCTCAGTGT
TACAAGCATCGCCAGCTCTTTCGCTCGAAGATCCAGCAGCCTCACGCAGAAAGCGAAGACGTGCGATGAGCCGTC
GGGAAGAGGGGACGTCAAGCGCCGGGGCTTCAAGAGCTCGACGGACGAGCTCTGGGCGGACGGCAAGAGTGCGGA
CGCGGAAACGCTTCGCAGATTGAAGAGGCCTCGGACAGGTCATGTGCTGGCTGCCGACGAGACAAAACCAGAGTC
ATCCCCGGTGAATATTTCTGGCGCAGCAAGGGTCGCCATACCAGTAGGAGGACAAGGCGCAGTCAGTACGCTGCG
GACGTCGTCGGCCAATAGCCAGCGAGTTGTCCGAGGCAAAAAGTCTGGCTCACAGCACGCGGACAAGGAGAACAA
GTGCGGAAGAGCCGGCGACGAGGTTTGGAGCCCGGGGCGGAAGGGAAAAGTCGCCGGCGGCAAGACGGACGAGGG
CAGCATCGGGCTGAAGAGCTATTTTCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail