Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3137
Gene name
Locationscaffold_25:18128..20085
Strand+
Gene length (bp)1957
Transcript length (bp)1404
Coding sequence length (bp)1401
Protein length (aa) 467

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 4.2E-69 94 453
PF00324 AA_permease Amino acid permease 1.5E-15 102 449

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50276|MUP1_YEAST High-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP1 PE=1 SV=1 32 451 4.0E-89
sp|P38734|MUP3_YEAST Low-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP3 PE=1 SV=1 67 454 3.0E-57
sp|Q8BGK6|YLAT2_MOUSE Y+L amino acid transporter 2 OS=Mus musculus GN=Slc7a6 PE=1 SV=1 87 435 3.0E-30
sp|Q9WTR6|XCT_MOUSE Cystine/glutamate transporter OS=Mus musculus GN=Slc7a11 PE=1 SV=1 87 405 1.0E-28
sp|Q92536|YLAT2_HUMAN Y+L amino acid transporter 2 OS=Homo sapiens GN=SLC7A6 PE=1 SV=3 56 405 2.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50276|MUP1_YEAST High-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP1 PE=1 SV=1 32 451 4.0E-89
sp|P38734|MUP3_YEAST Low-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP3 PE=1 SV=1 67 454 3.0E-57
sp|Q8BGK6|YLAT2_MOUSE Y+L amino acid transporter 2 OS=Mus musculus GN=Slc7a6 PE=1 SV=1 87 435 3.0E-30
sp|Q9WTR6|XCT_MOUSE Cystine/glutamate transporter OS=Mus musculus GN=Slc7a11 PE=1 SV=1 87 405 1.0E-28
sp|Q92536|YLAT2_HUMAN Y+L amino acid transporter 2 OS=Homo sapiens GN=SLC7A6 PE=1 SV=3 56 405 2.0E-28
sp|Q9R0S5|YLAT1_RAT Y+L amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a7 PE=1 SV=1 56 434 3.0E-28
sp|Q59I64|YLAT2_DANRE Y+L amino acid transporter 2 OS=Danio rerio GN=slc7a6 PE=2 SV=1 87 405 5.0E-28
sp|Q28I80|YLAT2_XENTR Y+L amino acid transporter 2 OS=Xenopus tropicalis GN=slc7a6 PE=2 SV=1 59 434 1.0E-27
sp|A1L3M3|YLAT2_XENLA Y+L amino acid transporter 2 OS=Xenopus laevis GN=slc7a6 PE=2 SV=1 87 434 3.0E-27
sp|Q9N1Q4|LAT2_RABIT Large neutral amino acids transporter small subunit 2 OS=Oryctolagus cuniculus GN=SLC7A8 PE=1 SV=1 65 446 9.0E-27
sp|Q9Z1K8|YLAT1_MOUSE Y+L amino acid transporter 1 OS=Mus musculus GN=Slc7a7 PE=1 SV=1 56 434 9.0E-27
sp|Q5RAE3|LAT2_PONAB Large neutral amino acids transporter small subunit 2 OS=Pongo abelii GN=SLC7A8 PE=2 SV=2 87 446 2.0E-26
sp|Q9UHI5|LAT2_HUMAN Large neutral amino acids transporter small subunit 2 OS=Homo sapiens GN=SLC7A8 PE=1 SV=1 87 446 2.0E-26
sp|Q9QXW9|LAT2_MOUSE Large neutral amino acids transporter small subunit 2 OS=Mus musculus GN=Slc7a8 PE=1 SV=1 87 405 3.0E-26
sp|Q9WVR6|LAT2_RAT Large neutral amino acids transporter small subunit 2 OS=Rattus norvegicus GN=Slc7a8 PE=1 SV=1 87 405 6.0E-26
sp|Q9UM01|YLAT1_HUMAN Y+L amino acid transporter 1 OS=Homo sapiens GN=SLC7A7 PE=1 SV=2 56 434 8.0E-26
sp|Q9N1R6|BAT1_RABIT b(0,+)-type amino acid transporter 1 OS=Oryctolagus cuniculus GN=SLC7A9 PE=1 SV=1 87 446 2.0E-25
sp|Q5RAG7|XCT_PONAB Cystine/glutamate transporter OS=Pongo abelii GN=SLC7A11 PE=2 SV=1 111 405 3.0E-25
sp|Q9UPY5|XCT_HUMAN Cystine/glutamate transporter OS=Homo sapiens GN=SLC7A11 PE=1 SV=1 111 405 3.0E-25
sp|P82251|BAT1_HUMAN b(0,+)-type amino acid transporter 1 OS=Homo sapiens GN=SLC7A9 PE=1 SV=1 87 446 6.0E-25
sp|Q9QXA6|BAT1_MOUSE b(0,+)-type amino acid transporter 1 OS=Mus musculus GN=Slc7a9 PE=1 SV=1 56 420 1.0E-24
sp|P63116|AAA1_RAT Asc-type amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a10 PE=2 SV=1 111 405 5.0E-24
sp|P63115|AAA1_MOUSE Asc-type amino acid transporter 1 OS=Mus musculus GN=Slc7a10 PE=1 SV=1 111 405 5.0E-24
sp|P82252|BAT1_RAT b(0,+)-type amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a9 PE=1 SV=1 57 420 4.0E-22
sp|Q9NS82|AAA1_HUMAN Asc-type amino acid transporter 1 OS=Homo sapiens GN=SLC7A10 PE=2 SV=1 111 450 2.0E-21
sp|Q9Z127|LAT1_MOUSE Large neutral amino acids transporter small subunit 1 OS=Mus musculus GN=Slc7a5 PE=1 SV=2 76 405 4.0E-18
sp|Q63016|LAT1_RAT Large neutral amino acids transporter small subunit 1 OS=Rattus norvegicus GN=Slc7a5 PE=1 SV=2 76 405 1.0E-17
sp|Q01650|LAT1_HUMAN Large neutral amino acids transporter small subunit 1 OS=Homo sapiens GN=SLC7A5 PE=1 SV=2 87 405 1.0E-17
sp|Q7YQK4|LAT1_RABIT Large neutral amino acids transporter small subunit 1 OS=Oryctolagus cuniculus GN=SLC7A5 PE=1 SV=1 87 405 7.0E-17
sp|Q8TCU3|S7A13_HUMAN Solute carrier family 7 member 13 OS=Homo sapiens GN=SLC7A13 PE=2 SV=1 94 418 1.0E-16
sp|Q5RKI7|S7A13_RAT Solute carrier family 7 member 13 OS=Rattus norvegicus GN=Slc7a13 PE=2 SV=1 75 405 3.0E-15
sp|Q91WN3|S7A13_MOUSE Solute carrier family 7 member 13 OS=Mus musculus GN=Slc7a13 PE=1 SV=1 87 418 1.0E-12
sp|O34739|STET_BACSU Serine/threonine exchanger SteT OS=Bacillus subtilis (strain 168) GN=steT PE=1 SV=1 87 439 4.0E-12
sp|Q8X845|FRLA_ECO57 Putative fructoselysine transporter FrlA OS=Escherichia coli O157:H7 GN=frlA PE=3 SV=2 87 426 4.0E-09
sp|P45539|FRLA_ECOLI Putative fructoselysine transporter FrlA OS=Escherichia coli (strain K12) GN=frlA PE=3 SV=2 87 426 9.0E-09
sp|Q7VEQ4|ANSP1_MYCBO L-asparagine permease 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP1 PE=3 SV=1 134 460 3.0E-06
sp|P9WQM9|ANSP1_MYCTU L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP1 PE=1 SV=1 134 460 3.0E-06
sp|P9WQM8|ANSP1_MYCTO L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP1 PE=3 SV=1 134 460 3.0E-06
sp|Q8MH63|LAT1N_HUMAN Putative L-type amino acid transporter 1-like protein MLAS OS=Homo sapiens GN=SLC7A5P1 PE=5 SV=1 87 164 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 90 112 22
2 127 149 22
3 170 192 22
4 207 229 22
5 236 258 22
6 317 339 22
7 368 390 22
8 427 449 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3137
MALPGLCQGWACHLTSSLKVGALDLCSVVPASYLSQVTIAMSDPKLAVAALGTWHQEEVSSPVEADDAHVSDALL
GVDSQTYALPEDRKIGIGGTMFLIFNKVIGTGIFSTPSAVFAATGSVGISLMLWVVGAIVALCGMSVFLEFGLAI
PLSGGTKNYVERVYRRPRYLASCLVAAHAVLLGFSSANALSFGRYVLRATSGNGNDGWQARCIAIAVVTLAIVMH
SVFPKWGVKLLNILGISKVFVLVFIVCAGFAALAGHRRVPDPRNFDDAFTSINGGGAYEYSKALLMVIYSYSGWE
GATYVMGELKRPGKTLAVAAPFAIGSVAVLYVLANVAYFAAIPREQLAQSEVLVADFFFRCMFGNTAAAHVLPLL
VALSNMGNILAASFATSRITQEMAKEGLLPFSRFWASNRPFNAPAASLLLHWVITVIVLVAPPPGPAYTLIINIS
SSGRLLGTRTSQWQPSS
Coding >Ophio5|3137
ATGGCTCTGCCAGGGCTCTGCCAGGGCTGGGCCTGCCACTTGACCTCCAGCCTCAAAGTAGGGGCCCTGGACCTC
TGCTCAGTCGTCCCAGCCTCTTATCTGTCCCAAGTCACAATCGCCATGTCAGACCCGAAGCTGGCCGTCGCCGCT
CTCGGCACATGGCATCAGGAGGAAGTGTCGTCTCCCGTCGAAGCCGACGATGCCCATGTGTCGGACGCGCTCCTG
GGTGTCGATTCGCAGACGTACGCGCTCCCCGAGGACCGCAAGATCGGCATCGGTGGCACCATGTTTCTCATCTTC
AACAAGGTCATCGGGACCGGCATCTTCTCTACGCCATCGGCCGTCTTCGCCGCCACCGGCTCCGTCGGCATAAGC
CTCATGCTTTGGGTCGTCGGCGCCATCGTCGCCTTGTGCGGCATGAGCGTTTTCCTCGAATTCGGCCTCGCCATC
CCGCTCTCAGGCGGCACCAAAAACTACGTCGAGCGCGTCTACAGGCGACCGCGATATCTGGCCTCGTGCCTCGTC
GCCGCCCATGCCGTTTTACTCGGCTTCTCCTCCGCCAACGCCCTCTCCTTTGGCCGCTACGTGCTGCGCGCCACG
TCCGGTAACGGCAATGACGGCTGGCAGGCGCGCTGTATTGCCATCGCCGTCGTCACCTTGGCTATTGTCATGCAT
AGCGTCTTCCCCAAATGGGGTGTCAAGCTCCTCAATATCCTCGGCATCTCCAAGGTCTTCGTTCTCGTCTTCATC
GTCTGCGCCGGCTTTGCCGCCCTGGCCGGCCACCGCCGCGTGCCGGACCCGCGCAACTTCGACGACGCCTTCACA
TCGATCAACGGCGGCGGCGCCTACGAGTACTCCAAGGCGCTGCTCATGGTCATCTACAGCTACAGCGGGTGGGAA
GGCGCGACGTACGTCATGGGCGAGCTGAAGCGTCCAGGCAAGACGCTGGCGGTGGCGGCGCCCTTTGCCATTGGC
AGCGTCGCCGTCTTGTACGTGCTGGCCAACGTGGCCTATTTTGCGGCGATCCCCAGGGAGCAGCTGGCGCAATCC
GAGGTGCTCGTGGCCGACTTCTTCTTCCGCTGCATGTTCGGCAACACGGCGGCGGCGCACGTGCTGCCGCTGCTG
GTGGCGCTCAGCAACATGGGCAATATTCTGGCTGCGAGCTTCGCCACGTCTCGCATAACGCAGGAGATGGCCAAG
GAGGGCCTGCTGCCCTTTAGCCGTTTCTGGGCCTCCAACCGGCCCTTTAACGCGCCGGCAGCGTCGCTTCTCCTG
CACTGGGTCATCACCGTCATCGTCCTGGTAGCGCCGCCGCCGGGGCCGGCCTACACACTCATCATTAACATATCA
TCAAGTGGACGTCTCCTTGGCACACGCACCTCGCAGTGGCAGCCGTCTTCC
Transcript >Ophio5|3137
ATGGCTCTGCCAGGGCTCTGCCAGGGCTGGGCCTGCCACTTGACCTCCAGCCTCAAAGTAGGGGCCCTGGACCTC
TGCTCAGTCGTCCCAGCCTCTTATCTGTCCCAAGTCACAATCGCCATGTCAGACCCGAAGCTGGCCGTCGCCGCT
CTCGGCACATGGCATCAGGAGGAAGTGTCGTCTCCCGTCGAAGCCGACGATGCCCATGTGTCGGACGCGCTCCTG
GGTGTCGATTCGCAGACGTACGCGCTCCCCGAGGACCGCAAGATCGGCATCGGTGGCACCATGTTTCTCATCTTC
AACAAGGTCATCGGGACCGGCATCTTCTCTACGCCATCGGCCGTCTTCGCCGCCACCGGCTCCGTCGGCATAAGC
CTCATGCTTTGGGTCGTCGGCGCCATCGTCGCCTTGTGCGGCATGAGCGTTTTCCTCGAATTCGGCCTCGCCATC
CCGCTCTCAGGCGGCACCAAAAACTACGTCGAGCGCGTCTACAGGCGACCGCGATATCTGGCCTCGTGCCTCGTC
GCCGCCCATGCCGTTTTACTCGGCTTCTCCTCCGCCAACGCCCTCTCCTTTGGCCGCTACGTGCTGCGCGCCACG
TCCGGTAACGGCAATGACGGCTGGCAGGCGCGCTGTATTGCCATCGCCGTCGTCACCTTGGCTATTGTCATGCAT
AGCGTCTTCCCCAAATGGGGTGTCAAGCTCCTCAATATCCTCGGCATCTCCAAGGTCTTCGTTCTCGTCTTCATC
GTCTGCGCCGGCTTTGCCGCCCTGGCCGGCCACCGCCGCGTGCCGGACCCGCGCAACTTCGACGACGCCTTCACA
TCGATCAACGGCGGCGGCGCCTACGAGTACTCCAAGGCGCTGCTCATGGTCATCTACAGCTACAGCGGGTGGGAA
GGCGCGACGTACGTCATGGGCGAGCTGAAGCGTCCAGGCAAGACGCTGGCGGTGGCGGCGCCCTTTGCCATTGGC
AGCGTCGCCGTCTTGTACGTGCTGGCCAACGTGGCCTATTTTGCGGCGATCCCCAGGGAGCAGCTGGCGCAATCC
GAGGTGCTCGTGGCCGACTTCTTCTTCCGCTGCATGTTCGGCAACACGGCGGCGGCGCACGTGCTGCCGCTGCTG
GTGGCGCTCAGCAACATGGGCAATATTCTGGCTGCGAGCTTCGCCACGTCTCGCATAACGCAGGAGATGGCCAAG
GAGGGCCTGCTGCCCTTTAGCCGTTTCTGGGCCTCCAACCGGCCCTTTAACGCGCCGGCAGCGTCGCTTCTCCTG
CACTGGGTCATCACCGTCATCGTCCTGGTAGCGCCGCCGCCGGGGCCGGCCTACACACTCATCATTAACATATCA
TCAAGTGGACGTCTCCTTGGCACACGCACCTCGCAGTGGCAGCCGTCTTCCTAG
Gene >Ophio5|3137
ATGGCTCTGCCAGGGCTCTGCCAGGGCTGGGCCTGCCACTTGACCTGTGCGTCTGCCGCCGCCAGCCCTTCTTAG
TATTGATACATCCGCGGCATATGCAACTTGGGGCGGGGAACCAGGTACGGATGAAGCTTACCTACCTACCTACCT
ACCTACCGGCCTGTCTAACTTACCTTACAAGCCAGCCTCAAAGTAGGGGCCCTGGACCTCTGCTCAGGTGAGACA
GCTTCTGCTGTTTGTCCCCTTTACGAATGCTCAGCTCGAGATCGTTGGTCAGTCGTCCCAGCCTCGTGAGCACGG
CACGCCCTCGGCCGCGCCGACGTCCTTCTAGCCGTCCGTTGCTCCCCTCTTGGGAAGCAGAGAGGGGATTATAGG
CGTGGGCACGGCCGACGGGCTCGTTGGACAGTTATCTGTCCCAAGTCACAATCGCCATGTCAGACCCGAAGCTGG
CCGTCGCCGCTCTCGGCACATGGCATCAGGAGGAAGTGTCGTCTCCCGTCGAAGCCGACGATGCCCATGTGTCGG
ACGCGCTCCTGGGTGTCGATTCGCAGACGTACGCGCTCCCCGAGGACCGCAAGATCGGCATCGGTGGCACCATGT
TTCTCATCTTCAACAAGGTCATCGGGACCGGCAGTGAGTGCGCCTTGTTGCGAACCAAGTGTCAAGCAAGCAGAC
CGCAGAGCTAACGGGCCGCAGTCTTCTCTACGCCATCGGCCGTCTTCGCCGCCACCGGCTCCGTCGGCATAAGCC
TCATGCTTTGGGTCGTCGGCGCCATCGTCGCCTTGTGCGGCATGAGCGTTTTCCTCGAATTCGGCCTCGCCATCC
CGCTCTCAGGCGGCACCAAAAACTACGTCGAGCGCGTCTACAGGCGACCGCGATATCTGGCCTCGTGCCTCGTCG
CCGCCCATGCCGTTTTACTCGGCTTCTCCTCCGCCAACGCCCTCTCCTTTGGCCGCTACGTGCTGCGCGCCACGT
CCGGTAACGGCAATGACGGCTGGCAGGCGCGCTGTATTGCCATCGCCGTCGTCACCTTGGCTATTGTCATGCATA
GCGTCTTCCCCAAATGGGGTGTCAAGCTCCTCAATATCCTCGGCATCTCCAAGGTCTTCGTTCTCGTCTTCATCG
TCTGCGCCGGCTTTGCCGCCCTGGCCGGCCACCGCCGCGTGCCGGACCCGCGCAACTTCGACGACGCCTTCACAT
CGATCAACGGCGGCGGCGCCTACGAGTACTCCAAGGCGCTGCTCATGGTCATCTACAGCTACAGCGGGTGGGAAG
GCGCGACGTACGTCATGGGCGAGCTGAAGCGTCCAGGCAAGACGCTGGCGGTGGCGGCGCCCTTTGCCATTGGCA
GCGTCGCCGTCTTGTACGTGCTGGCCAACGTGGCCTATTTTGCGGCGATCCCCAGGGAGCAGCTGGCGCAATCCG
AGGTGCTCGTGGCCGACTTCTTCTTCCGCTGCATGTTCGGCAACACGGCGGCGGCGCACGTGCTGCCGCTGCTGG
TGGCGCTCAGCAACATGGGCAATATTCTGGCTGCGAGCTTCGCCACGTCTCGCATAACGCAGGAGATGGCCAAGG
AGGGCCTGCTGCCCTTTAGCCGTTTCTGGGCCTCCAACCGGCCCTTTAACGCGCCGGCAGCGTCGGTAGGCAGAG
GCCGCGATGACGTGTGGTGGATGAGATGAGCTGACGGTGGACAGCTTCTCCTGCACTGGGTCATCACCGTCATCG
TCCTGGTAGCGCCGCCGCCGGGGCCGGCCTACACACTCATCATTAACATGTATTCGCTGTTCTATCTCCGGACAC
GGGTCGGTGTGCTGACCTTTGCTGGGCAGATCATCGTACGCTCACGCGTGGATCAACACGCTGGTGGTGGCCGGC
CTCTTGTGGCTCCACTACAAGAAGTCGGAGAAGTGGACGTCTCCTTGGCACACGCACCTCGCAGTGGCAGCCGTC
TTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail