Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|313
Gene name
Locationscaffold_107:13050..14209
Strand+
Gene length (bp)1159
Transcript length (bp)903
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00578 AhpC-TSA AhpC/TSA family 7.9E-23 161 276
PF08534 Redoxin Redoxin 2.7E-13 165 282

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94561|PRX_SCHPO Peroxiredoxin C1773.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.02c PE=3 SV=1 105 297 5.0E-20
sp|P9WIE1|BCP_MYCTU Putative peroxiredoxin Rv2521 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bcp PE=1 SV=1 184 280 6.0E-20
sp|P9WIE0|BCP_MYCTO Putative peroxiredoxin MT2597 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bcp PE=3 SV=1 184 280 6.0E-20
sp|P40553|DOT5_YEAST Peroxiredoxin DOT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOT5 PE=1 SV=1 165 300 1.0E-19
sp|Q83CY8|BCP_COXBU Putative peroxiredoxin bcp OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=bcp PE=1 SV=1 177 291 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94561|PRX_SCHPO Peroxiredoxin C1773.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.02c PE=3 SV=1 105 297 5.0E-20
sp|P9WIE1|BCP_MYCTU Putative peroxiredoxin Rv2521 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bcp PE=1 SV=1 184 280 6.0E-20
sp|P9WIE0|BCP_MYCTO Putative peroxiredoxin MT2597 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bcp PE=3 SV=1 184 280 6.0E-20
sp|P40553|DOT5_YEAST Peroxiredoxin DOT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOT5 PE=1 SV=1 165 300 1.0E-19
sp|Q83CY8|BCP_COXBU Putative peroxiredoxin bcp OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=bcp PE=1 SV=1 177 291 2.0E-17
sp|P9WID9|BCPB_MYCTU Putative peroxiredoxin Rv1608c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bcpB PE=1 SV=1 151 277 2.0E-16
sp|P9WID8|BCPB_MYCTO Putative peroxiredoxin MT1643 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bcpB PE=3 SV=1 151 277 2.0E-16
sp|P0AE53|BCP_ECOL6 Putative peroxiredoxin bcp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=bcp PE=3 SV=1 165 276 1.0E-15
sp|Q796Y8|BCP_BACSU Putative peroxiredoxin YgaF OS=Bacillus subtilis (strain 168) GN=ygaF PE=3 SV=1 175 277 1.0E-15
sp|P0AE54|BCP_ECO57 Putative peroxiredoxin bcp OS=Escherichia coli O157:H7 GN=bcp PE=3 SV=1 165 276 1.0E-15
sp|P0AE52|BCP_ECOLI Putative peroxiredoxin bcp OS=Escherichia coli (strain K12) GN=bcp PE=1 SV=1 165 276 1.0E-15
sp|P0AE55|BCP_SHIFL Putative peroxiredoxin bcp OS=Shigella flexneri GN=bcp PE=3 SV=1 165 276 1.0E-15
sp|Q6QPJ6|PRXQ_POPJC Peroxiredoxin Q, chloroplastic OS=Populus jackii GN=PRXQ PE=1 SV=1 163 298 9.0E-15
sp|Q6UBI3|PERQ_SUASA Peroxiredoxin Q, chloroplastic OS=Suaeda salsa GN=PRXQ PE=1 SV=1 163 298 5.0E-14
sp|Q75SY5|PRXQ_GENTR Peroxiredoxin Q, chloroplastic OS=Gentiana triflora GN=AFP1 PE=1 SV=1 163 276 6.0E-14
sp|P44411|BCP_HAEIN Putative peroxiredoxin bcp OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcp PE=3 SV=1 184 277 1.0E-13
sp|Q9LU86|PRXQ_ARATH Peroxiredoxin Q, chloroplastic OS=Arabidopsis thaliana GN=PRXQ PE=1 SV=1 163 276 1.0E-13
sp|P0C5D5|PRXQ_ORYSJ Peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0196300 PE=1 SV=1 163 276 2.0E-13
sp|Q9MB35|PERQ_SEDLI Peroxiredoxin Q, chloroplastic (Fragment) OS=Sedum lineare GN=PRXQ PE=1 SV=1 163 298 2.0E-13
sp|P0C5D4|PRXQ_ORYSI Putative peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_22010 PE=1 SV=1 163 276 2.0E-13
sp|Q5S1S6|PRXQ_WHEAT Peroxiredoxin Q, chloroplastic OS=Triticum aestivum GN=PRX1 PE=1 SV=1 163 276 3.0E-13
sp|Q9ZHF0|BCP_BUCAP Putative peroxiredoxin bcp OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=bcp PE=3 SV=2 175 276 2.0E-11
sp|Q9Y9L0|TDXH_AERPE Peroxiredoxin OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_2278 PE=1 SV=1 185 298 5.0E-10
sp|A8A9P0|TDXH_IGNH4 Peroxiredoxin OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=Igni_0459 PE=3 SV=1 174 298 4.0E-09
sp|P55979|BCP_HELPY Putative peroxiredoxin bcp OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=bcp PE=3 SV=1 158 279 2.0E-08
sp|Q9ZMU4|BCP_HELPJ Putative peroxiredoxin bcp OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=bcp PE=3 SV=1 158 279 3.0E-08
sp|Q58146|TDXH_METJA Peroxiredoxin OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0736 PE=3 SV=2 185 298 6.0E-08
sp|A4FWZ9|TDXH_METM5 Peroxiredoxin OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0413 PE=3 SV=1 185 298 8.0E-08
sp|A2BJD9|TDXH_HYPBU Peroxiredoxin OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=Hbut_0228 PE=3 SV=1 185 298 8.0E-08
sp|A6UPH7|TDXH_METVS Peroxiredoxin OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0492 PE=3 SV=1 185 298 2.0E-07
sp|Q6LY19|TDXH_METMP Peroxiredoxin OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1174 PE=3 SV=1 185 298 2.0E-07
sp|Q74NC6|TDXH_NANEQ Peroxiredoxin OS=Nanoarchaeum equitans (strain Kin4-M) GN=NEQ191 PE=3 SV=1 185 298 3.0E-07
sp|A3DKL1|TDXH_STAMF Peroxiredoxin OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=Smar_0058 PE=3 SV=1 185 298 3.0E-07
sp|Q9WZR4|TDXH_THEMA Peroxiredoxin OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0807 PE=3 SV=1 169 298 1.0E-06
sp|A5IIX7|TDXH_THEP1 Peroxiredoxin OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=Tpet_0121 PE=3 SV=1 169 298 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016209 antioxidant activity Yes
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|313
MEQYNSLSNTALVRHVSAMTTNKPSPPQPHPHPLYLSLTLSVLPPPGPQPRLSVLFIDLISTSIFSSSSTFLIPF
FLYTYSQFPSQSIPMPVELRKRKAPQPPPAPAPAPKKSAKAKKASPAKEERQEEEEPKDASQPREQKQKSTSVAV
GDVIDLQDFGGEIEDQNGCKTTLKKLVDDCKTAVVLFTYPKASTPGCTVQACLFRDAYEPLLAEGLSVYGLSTDQ
PKANTSFKEKQKLQYPLLCDPQATLIGAIGFKKQPKGTQRGVFVVDKKGKVLVCQPGGPAATVDRVKQLVEELSK
Coding >Ophio5|313
ATGGAACAGTACAACTCCTTGTCGAATACGGCCCTCGTCCGGCATGTATCGGCTATGACGACCAACAAACCATCT
CCGCCTCAACCGCATCCTCATCCTCTCTATCTCTCTCTCACTCTCTCTGTGCTCCCCCCCCCCGGACCTCAACCG
AGACTCTCTGTTCTGTTTATTGATCTTATCTCAACCTCTATATTCTCCTCCTCCTCTACCTTTTTGATCCCTTTC
TTCCTCTATACTTACAGTCAATTCCCTTCCCAATCGATTCCGATGCCCGTCGAGCTCCGAAAGCGCAAGGCCCCG
CAGCCGCCCCCCGCTCCGGCGCCCGCACCTAAAAAGTCGGCCAAGGCTAAGAAGGCTTCGCCTGCCAAAGAGGAG
CGGCAGGAGGAAGAGGAGCCGAAAGATGCGTCTCAGCCACGGGAGCAGAAGCAAAAGTCGACCAGTGTCGCTGTG
GGAGACGTCATCGACCTCCAAGACTTTGGCGGGGAGATCGAGGACCAGAACGGCTGCAAGACGACGCTCAAGAAG
CTAGTCGACGATTGCAAGACGGCCGTCGTCCTCTTCACCTACCCCAAGGCTTCAACGCCCGGCTGTACTGTCCAG
GCCTGCCTCTTCCGCGACGCCTACGAACCCCTCCTCGCCGAGGGTCTCTCCGTCTATGGCCTCAGCACGGACCAG
CCCAAGGCAAACACAAGTTTCAAGGAAAAACAGAAGCTGCAGTATCCGCTACTGTGCGACCCGCAGGCCACCCTC
ATCGGCGCCATTGGCTTCAAGAAGCAGCCCAAGGGCACCCAGCGCGGCGTCTTCGTCGTCGATAAAAAGGGAAAA
GTCCTCGTGTGCCAGCCGGGCGGGCCTGCTGCTACCGTCGATCGCGTCAAGCAGCTGGTTGAGGAGCTGAGCAAG
Transcript >Ophio5|313
ATGGAACAGTACAACTCCTTGTCGAATACGGCCCTCGTCCGGCATGTATCGGCTATGACGACCAACAAACCATCT
CCGCCTCAACCGCATCCTCATCCTCTCTATCTCTCTCTCACTCTCTCTGTGCTCCCCCCCCCCGGACCTCAACCG
AGACTCTCTGTTCTGTTTATTGATCTTATCTCAACCTCTATATTCTCCTCCTCCTCTACCTTTTTGATCCCTTTC
TTCCTCTATACTTACAGTCAATTCCCTTCCCAATCGATTCCGATGCCCGTCGAGCTCCGAAAGCGCAAGGCCCCG
CAGCCGCCCCCCGCTCCGGCGCCCGCACCTAAAAAGTCGGCCAAGGCTAAGAAGGCTTCGCCTGCCAAAGAGGAG
CGGCAGGAGGAAGAGGAGCCGAAAGATGCGTCTCAGCCACGGGAGCAGAAGCAAAAGTCGACCAGTGTCGCTGTG
GGAGACGTCATCGACCTCCAAGACTTTGGCGGGGAGATCGAGGACCAGAACGGCTGCAAGACGACGCTCAAGAAG
CTAGTCGACGATTGCAAGACGGCCGTCGTCCTCTTCACCTACCCCAAGGCTTCAACGCCCGGCTGTACTGTCCAG
GCCTGCCTCTTCCGCGACGCCTACGAACCCCTCCTCGCCGAGGGTCTCTCCGTCTATGGCCTCAGCACGGACCAG
CCCAAGGCAAACACAAGTTTCAAGGAAAAACAGAAGCTGCAGTATCCGCTACTGTGCGACCCGCAGGCCACCCTC
ATCGGCGCCATTGGCTTCAAGAAGCAGCCCAAGGGCACCCAGCGCGGCGTCTTCGTCGTCGATAAAAAGGGAAAA
GTCCTCGTGTGCCAGCCGGGCGGGCCTGCTGCTACCGTCGATCGCGTCAAGCAGCTGGTTGAGGAGCTGAGCAAG
TGA
Gene >Ophio5|313
ATGGAACAGTACAACTCCTTGTCGGTGAGTAAAGTTCCGAGACGCCGGTTCGTCAGCCCGTCGTCAGGCCGTCGT
TTAACTAACGGTACCCGATTGAGAATACGGCCCTCGTCCGGCATGTATCGGCTATGACGACCAACAAACCATCTC
CGCCTCAACCGCATGTTCGCGATAGATTGAACGCGCGGATACCCCCCCCCCCCCAAAAAAAAAAACCGTCACCGC
GTCCAGCAAGATTCGCACCTCGGTTGTGATTGGTCAGTTGAGCGCACAACACGAATCGCCAGCCTCATCCTCTCT
ATCTCTCTCTCACTCTCTCTGTGCTCCCCCCCCCCGGACCTCAACCGAGACTCTCTGTTCTGTTTATTGATCTTA
TCTCAACCTCTATATTCTCCTCCTCCTCTACCTTTTTGATCCCTTTCTTCCTCTATACTTACAGTCAATTCCCTT
CCCAATCGATTCCGATGCCCGTCGAGCTCCGAAAGCGCAAGGCCCCGCAGCCGCCCCCCGCTCCGGCGCCCGCAC
CTAAAAAGTCGGCCAAGGCTAAGAAGGCTTCGCCTGCCAAAGAGGAGCGGCAGGAGGAAGAGGAGCCGAAAGATG
CGTCTCAGCCACGGGAGCAGAAGCAAAAGTCGACCAGTGTCGCTGTGGGAGACGTCATCGACCTCCAAGACTTTG
GCGGGGAGATCGAGGACCAGAACGGCTGCAAGACGACGCTCAAGAAGCTAGTCGACGATTGCAAGACGGCCGTCG
TCCTCTTCACCTACCCCAAGGCTTCAACGCCCGGCTGTGAGTGTTATTCCCCTTTCTGTACTCTCCCCTTGTATC
CTCAACTGAAGCCATCGCAGGTACTGTCCAGGCCTGCCTCTTCCGCGACGCCTACGAACCCCTCCTCGCCGAGGG
TCTCTCCGTCTATGGCCTCAGCACGGACCAGCCCAAGGCAAACACAAGTTTCAAGGAAAAACAGAAGCTGCAGTA
TCCGCTACTGTGCGACCCGCAGGCCACCCTCATCGGCGCCATTGGCTTCAAGAAGCAGCCCAAGGGCACCCAGCG
CGGCGTCTTCGTCGTCGATAAAAAGGGAAAAGTCCTCGTGTGCCAGCCGGGCGGGCCTGCTGCTACCGTCGATCG
CGTCAAGCAGCTGGTTGAGGAGCTGAGCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail