Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|313
Gene name
Locationscaffold_107:13050..14209
Strand+
Gene length (bp)1159
Transcript length (bp)903
Coding sequence length (bp)900
Protein length (aa) 300

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00578 AhpC-TSA AhpC/TSA family 7.9E-23 161 276
PF08534 Redoxin Redoxin 2.7E-13 165 282

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94561|PRX_SCHPO Peroxiredoxin C1773.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.02c PE=3 SV=1 105 297 5.0E-20
sp|P9WIE1|BCP_MYCTU Putative peroxiredoxin Rv2521 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bcp PE=1 SV=1 184 280 6.0E-20
sp|P9WIE0|BCP_MYCTO Putative peroxiredoxin MT2597 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bcp PE=3 SV=1 184 280 6.0E-20
sp|P40553|DOT5_YEAST Peroxiredoxin DOT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOT5 PE=1 SV=1 165 300 1.0E-19
sp|Q83CY8|BCP_COXBU Putative peroxiredoxin bcp OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=bcp PE=1 SV=1 177 291 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94561|PRX_SCHPO Peroxiredoxin C1773.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.02c PE=3 SV=1 105 297 5.0E-20
sp|P9WIE1|BCP_MYCTU Putative peroxiredoxin Rv2521 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bcp PE=1 SV=1 184 280 6.0E-20
sp|P9WIE0|BCP_MYCTO Putative peroxiredoxin MT2597 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bcp PE=3 SV=1 184 280 6.0E-20
sp|P40553|DOT5_YEAST Peroxiredoxin DOT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOT5 PE=1 SV=1 165 300 1.0E-19
sp|Q83CY8|BCP_COXBU Putative peroxiredoxin bcp OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=bcp PE=1 SV=1 177 291 2.0E-17
sp|P9WID9|BCPB_MYCTU Putative peroxiredoxin Rv1608c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bcpB PE=1 SV=1 151 277 2.0E-16
sp|P9WID8|BCPB_MYCTO Putative peroxiredoxin MT1643 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bcpB PE=3 SV=1 151 277 2.0E-16
sp|P0AE53|BCP_ECOL6 Putative peroxiredoxin bcp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=bcp PE=3 SV=1 165 276 1.0E-15
sp|Q796Y8|BCP_BACSU Putative peroxiredoxin YgaF OS=Bacillus subtilis (strain 168) GN=ygaF PE=3 SV=1 175 277 1.0E-15
sp|P0AE54|BCP_ECO57 Putative peroxiredoxin bcp OS=Escherichia coli O157:H7 GN=bcp PE=3 SV=1 165 276 1.0E-15
sp|P0AE52|BCP_ECOLI Putative peroxiredoxin bcp OS=Escherichia coli (strain K12) GN=bcp PE=1 SV=1 165 276 1.0E-15
sp|P0AE55|BCP_SHIFL Putative peroxiredoxin bcp OS=Shigella flexneri GN=bcp PE=3 SV=1 165 276 1.0E-15
sp|Q6QPJ6|PRXQ_POPJC Peroxiredoxin Q, chloroplastic OS=Populus jackii GN=PRXQ PE=1 SV=1 163 298 9.0E-15
sp|Q6UBI3|PERQ_SUASA Peroxiredoxin Q, chloroplastic OS=Suaeda salsa GN=PRXQ PE=1 SV=1 163 298 5.0E-14
sp|Q75SY5|PRXQ_GENTR Peroxiredoxin Q, chloroplastic OS=Gentiana triflora GN=AFP1 PE=1 SV=1 163 276 6.0E-14
sp|P44411|BCP_HAEIN Putative peroxiredoxin bcp OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcp PE=3 SV=1 184 277 1.0E-13
sp|Q9LU86|PRXQ_ARATH Peroxiredoxin Q, chloroplastic OS=Arabidopsis thaliana GN=PRXQ PE=1 SV=1 163 276 1.0E-13
sp|P0C5D5|PRXQ_ORYSJ Peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0196300 PE=1 SV=1 163 276 2.0E-13
sp|Q9MB35|PERQ_SEDLI Peroxiredoxin Q, chloroplastic (Fragment) OS=Sedum lineare GN=PRXQ PE=1 SV=1 163 298 2.0E-13
sp|P0C5D4|PRXQ_ORYSI Putative peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_22010 PE=1 SV=1 163 276 2.0E-13
sp|Q5S1S6|PRXQ_WHEAT Peroxiredoxin Q, chloroplastic OS=Triticum aestivum GN=PRX1 PE=1 SV=1 163 276 3.0E-13
sp|Q9ZHF0|BCP_BUCAP Putative peroxiredoxin bcp OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=bcp PE=3 SV=2 175 276 2.0E-11
sp|Q9Y9L0|TDXH_AERPE Peroxiredoxin OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_2278 PE=1 SV=1 185 298 5.0E-10
sp|A8A9P0|TDXH_IGNH4 Peroxiredoxin OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=Igni_0459 PE=3 SV=1 174 298 4.0E-09
sp|P55979|BCP_HELPY Putative peroxiredoxin bcp OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=bcp PE=3 SV=1 158 279 2.0E-08
sp|Q9ZMU4|BCP_HELPJ Putative peroxiredoxin bcp OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=bcp PE=3 SV=1 158 279 3.0E-08
sp|Q58146|TDXH_METJA Peroxiredoxin OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0736 PE=3 SV=2 185 298 6.0E-08
sp|A4FWZ9|TDXH_METM5 Peroxiredoxin OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0413 PE=3 SV=1 185 298 8.0E-08
sp|A2BJD9|TDXH_HYPBU Peroxiredoxin OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=Hbut_0228 PE=3 SV=1 185 298 8.0E-08
sp|A6UPH7|TDXH_METVS Peroxiredoxin OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0492 PE=3 SV=1 185 298 2.0E-07
sp|Q6LY19|TDXH_METMP Peroxiredoxin OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1174 PE=3 SV=1 185 298 2.0E-07
sp|Q74NC6|TDXH_NANEQ Peroxiredoxin OS=Nanoarchaeum equitans (strain Kin4-M) GN=NEQ191 PE=3 SV=1 185 298 3.0E-07
sp|A3DKL1|TDXH_STAMF Peroxiredoxin OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=Smar_0058 PE=3 SV=1 185 298 3.0E-07
sp|Q9WZR4|TDXH_THEMA Peroxiredoxin OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0807 PE=3 SV=1 169 298 1.0E-06
sp|A5IIX7|TDXH_THEP1 Peroxiredoxin OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=Tpet_0121 PE=3 SV=1 169 298 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016209 antioxidant activity Yes
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3036 0.765 0.0847 0.065 0.1446 0.0317 0.1181 0.0145 0.0458 0.0068

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3673
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4987
Ophiocordyceps australis map64 (Brazil) OphauB2|626
Ophiocordyceps camponoti-floridani Ophcf2|06823
Ophiocordyceps camponoti-rufipedis Ophun1|4271
Ophiocordyceps kimflemingae Ophio5|313 (this protein)
Ophiocordyceps subramaniannii Hirsu2|71

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|313
MEQYNSLSNTALVRHVSAMTTNKPSPPQPHPHPLYLSLTLSVLPPPGPQPRLSVLFIDLISTSIFSSSSTFLIPF
FLYTYSQFPSQSIPMPVELRKRKAPQPPPAPAPAPKKSAKAKKASPAKEERQEEEEPKDASQPREQKQKSTSVAV
GDVIDLQDFGGEIEDQNGCKTTLKKLVDDCKTAVVLFTYPKASTPGCTVQACLFRDAYEPLLAEGLSVYGLSTDQ
PKANTSFKEKQKLQYPLLCDPQATLIGAIGFKKQPKGTQRGVFVVDKKGKVLVCQPGGPAATVDRVKQLVEELSK
Coding >Ophio5|313
ATGGAACAGTACAACTCCTTGTCGAATACGGCCCTCGTCCGGCATGTATCGGCTATGACGACCAACAAACCATCT
CCGCCTCAACCGCATCCTCATCCTCTCTATCTCTCTCTCACTCTCTCTGTGCTCCCCCCCCCCGGACCTCAACCG
AGACTCTCTGTTCTGTTTATTGATCTTATCTCAACCTCTATATTCTCCTCCTCCTCTACCTTTTTGATCCCTTTC
TTCCTCTATACTTACAGTCAATTCCCTTCCCAATCGATTCCGATGCCCGTCGAGCTCCGAAAGCGCAAGGCCCCG
CAGCCGCCCCCCGCTCCGGCGCCCGCACCTAAAAAGTCGGCCAAGGCTAAGAAGGCTTCGCCTGCCAAAGAGGAG
CGGCAGGAGGAAGAGGAGCCGAAAGATGCGTCTCAGCCACGGGAGCAGAAGCAAAAGTCGACCAGTGTCGCTGTG
GGAGACGTCATCGACCTCCAAGACTTTGGCGGGGAGATCGAGGACCAGAACGGCTGCAAGACGACGCTCAAGAAG
CTAGTCGACGATTGCAAGACGGCCGTCGTCCTCTTCACCTACCCCAAGGCTTCAACGCCCGGCTGTACTGTCCAG
GCCTGCCTCTTCCGCGACGCCTACGAACCCCTCCTCGCCGAGGGTCTCTCCGTCTATGGCCTCAGCACGGACCAG
CCCAAGGCAAACACAAGTTTCAAGGAAAAACAGAAGCTGCAGTATCCGCTACTGTGCGACCCGCAGGCCACCCTC
ATCGGCGCCATTGGCTTCAAGAAGCAGCCCAAGGGCACCCAGCGCGGCGTCTTCGTCGTCGATAAAAAGGGAAAA
GTCCTCGTGTGCCAGCCGGGCGGGCCTGCTGCTACCGTCGATCGCGTCAAGCAGCTGGTTGAGGAGCTGAGCAAG
Transcript >Ophio5|313
ATGGAACAGTACAACTCCTTGTCGAATACGGCCCTCGTCCGGCATGTATCGGCTATGACGACCAACAAACCATCT
CCGCCTCAACCGCATCCTCATCCTCTCTATCTCTCTCTCACTCTCTCTGTGCTCCCCCCCCCCGGACCTCAACCG
AGACTCTCTGTTCTGTTTATTGATCTTATCTCAACCTCTATATTCTCCTCCTCCTCTACCTTTTTGATCCCTTTC
TTCCTCTATACTTACAGTCAATTCCCTTCCCAATCGATTCCGATGCCCGTCGAGCTCCGAAAGCGCAAGGCCCCG
CAGCCGCCCCCCGCTCCGGCGCCCGCACCTAAAAAGTCGGCCAAGGCTAAGAAGGCTTCGCCTGCCAAAGAGGAG
CGGCAGGAGGAAGAGGAGCCGAAAGATGCGTCTCAGCCACGGGAGCAGAAGCAAAAGTCGACCAGTGTCGCTGTG
GGAGACGTCATCGACCTCCAAGACTTTGGCGGGGAGATCGAGGACCAGAACGGCTGCAAGACGACGCTCAAGAAG
CTAGTCGACGATTGCAAGACGGCCGTCGTCCTCTTCACCTACCCCAAGGCTTCAACGCCCGGCTGTACTGTCCAG
GCCTGCCTCTTCCGCGACGCCTACGAACCCCTCCTCGCCGAGGGTCTCTCCGTCTATGGCCTCAGCACGGACCAG
CCCAAGGCAAACACAAGTTTCAAGGAAAAACAGAAGCTGCAGTATCCGCTACTGTGCGACCCGCAGGCCACCCTC
ATCGGCGCCATTGGCTTCAAGAAGCAGCCCAAGGGCACCCAGCGCGGCGTCTTCGTCGTCGATAAAAAGGGAAAA
GTCCTCGTGTGCCAGCCGGGCGGGCCTGCTGCTACCGTCGATCGCGTCAAGCAGCTGGTTGAGGAGCTGAGCAAG
TGA
Gene >Ophio5|313
ATGGAACAGTACAACTCCTTGTCGGTGAGTAAAGTTCCGAGACGCCGGTTCGTCAGCCCGTCGTCAGGCCGTCGT
TTAACTAACGGTACCCGATTGAGAATACGGCCCTCGTCCGGCATGTATCGGCTATGACGACCAACAAACCATCTC
CGCCTCAACCGCATGTTCGCGATAGATTGAACGCGCGGATACCCCCCCCCCCCCAAAAAAAAAAACCGTCACCGC
GTCCAGCAAGATTCGCACCTCGGTTGTGATTGGTCAGTTGAGCGCACAACACGAATCGCCAGCCTCATCCTCTCT
ATCTCTCTCTCACTCTCTCTGTGCTCCCCCCCCCCGGACCTCAACCGAGACTCTCTGTTCTGTTTATTGATCTTA
TCTCAACCTCTATATTCTCCTCCTCCTCTACCTTTTTGATCCCTTTCTTCCTCTATACTTACAGTCAATTCCCTT
CCCAATCGATTCCGATGCCCGTCGAGCTCCGAAAGCGCAAGGCCCCGCAGCCGCCCCCCGCTCCGGCGCCCGCAC
CTAAAAAGTCGGCCAAGGCTAAGAAGGCTTCGCCTGCCAAAGAGGAGCGGCAGGAGGAAGAGGAGCCGAAAGATG
CGTCTCAGCCACGGGAGCAGAAGCAAAAGTCGACCAGTGTCGCTGTGGGAGACGTCATCGACCTCCAAGACTTTG
GCGGGGAGATCGAGGACCAGAACGGCTGCAAGACGACGCTCAAGAAGCTAGTCGACGATTGCAAGACGGCCGTCG
TCCTCTTCACCTACCCCAAGGCTTCAACGCCCGGCTGTGAGTGTTATTCCCCTTTCTGTACTCTCCCCTTGTATC
CTCAACTGAAGCCATCGCAGGTACTGTCCAGGCCTGCCTCTTCCGCGACGCCTACGAACCCCTCCTCGCCGAGGG
TCTCTCCGTCTATGGCCTCAGCACGGACCAGCCCAAGGCAAACACAAGTTTCAAGGAAAAACAGAAGCTGCAGTA
TCCGCTACTGTGCGACCCGCAGGCCACCCTCATCGGCGCCATTGGCTTCAAGAAGCAGCCCAAGGGCACCCAGCG
CGGCGTCTTCGTCGTCGATAAAAAGGGAAAAGTCCTCGTGTGCCAGCCGGGCGGGCCTGCTGCTACCGTCGATCG
CGTCAAGCAGCTGGTTGAGGAGCTGAGCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail