Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3104
Gene name
Locationscaffold_247:17905..19554
Strand-
Gene length (bp)1649
Transcript length (bp)1353
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.3E-13 28 352

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 15 384 1.0E-55
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 7 392 2.0E-50
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 7 392 2.0E-50
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 7 392 1.0E-48
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 10 388 1.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 15 384 1.0E-55
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 7 392 2.0E-50
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 7 392 2.0E-50
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 7 392 1.0E-48
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 10 388 1.0E-36
sp|O25788|GLUP_HELPY Putative glucose/galactose transporter OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gluP PE=3 SV=1 25 380 9.0E-30
sp|Q9ZK41|GLUP_HELPJ Putative glucose/galactose transporter OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gluP PE=3 SV=1 25 380 5.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 20 39 19
2 83 105 22
3 112 131 19
4 151 173 22
5 186 208 22
6 237 259 22
7 300 319 19
8 323 345 22
9 357 379 22
10 383 405 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 48.76 26.18 71.35
CcL In ants, during behavior modification 197.45 81.00 313.90
CcD In ants, recently dead 101.21 54.90 147.52

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.008271 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3104
MFQHRDSSPRAELTGRQSLYPVCLVTSLFFLWGFSYGLLDTLNKHFQDTLGIGKSRSAGLQAAYFGAYPLASLGH
AAWTLQRFGYRATFVWGLCLYGLGAVLAIPAIKCRSFGGFCACIFVIGSGLGSLETAANPYMGACGPARYSEIRL
NIAQAFSGVGSVVAPVVGSFAFFRLDAEGALQNVQWIYLAVALLVFALAVIFFISDIPEAYEDDDETMAKGDNGG
LTSSQRWRLLHAALAQFCCTGAQIAIAGYFINYVTETRPRTRPALASQLLAGAQGAFALGRFVGAALMRFIRPRV
VLCAFTTLSVALVAPAVALRGNSGVLVICLSMFFESVCFPTIVALGIRGLGRHSRRGSGYVVGGIVGGACVPPLM
GAVADARGTAMGMTVPLGFLAAGWTYALAVNAVPAYRAVIDGGNSVESDSEGDGEPVMERSGEGVLELGRRWRRG
Coding >Ophio5|3104
ATGTTCCAACATCGAGACTCTTCCCCACGCGCCGAGCTCACGGGCCGTCAGTCGTTGTATCCCGTCTGTCTCGTC
ACCAGCCTCTTCTTCCTTTGGGGTTTCTCCTACGGCCTTCTTGACACGCTCAACAAGCACTTTCAAGACACGCTG
GGCATTGGCAAGTCACGATCTGCCGGTCTTCAAGCCGCCTACTTTGGAGCATACCCCCTGGCCTCGCTCGGTCAT
GCCGCCTGGACCTTGCAGCGGTTCGGTTACCGCGCCACCTTTGTCTGGGGCCTCTGTCTCTACGGCCTGGGGGCC
GTCTTGGCCATTCCAGCCATCAAGTGTCGGAGCTTCGGTGGTTTCTGCGCCTGCATCTTCGTTATTGGTAGCGGA
CTGGGCTCTCTCGAGACGGCTGCGAATCCGTACATGGGTGCTTGCGGTCCTGCACGATACTCCGAGATACGGCTC
AACATTGCGCAAGCCTTTAGCGGCGTAGGATCCGTCGTCGCTCCCGTCGTCGGCTCCTTCGCCTTCTTCCGGCTG
GATGCTGAGGGCGCGCTACAAAATGTTCAGTGGATCTACCTGGCTGTTGCCCTGCTCGTTTTTGCCCTCGCCGTC
ATCTTCTTCATATCTGACATCCCCGAGGCGTACGAAGACGATGATGAAACGATGGCCAAGGGCGACAACGGCGGG
CTGACATCGTCGCAACGATGGCGTCTTTTGCACGCGGCGTTGGCCCAGTTTTGCTGTACGGGCGCGCAGATTGCC
ATTGCCGGATACTTCATCAACTACGTGACGGAGACGCGACCTCGGACAAGACCGGCGCTGGCCTCGCAGCTCCTG
GCAGGTGCTCAAGGGGCCTTTGCCTTGGGTCGTTTTGTCGGCGCGGCACTGATGCGCTTCATCCGTCCGCGGGTA
GTTCTATGCGCTTTCACGACGCTGAGCGTCGCCCTGGTCGCTCCCGCCGTGGCCCTGCGCGGAAACTCGGGCGTC
CTGGTCATCTGTCTGTCCATGTTCTTCGAGTCAGTATGCTTTCCAACCATCGTGGCGCTGGGGATCCGGGGCCTG
GGCCGGCACAGCCGTCGAGGCTCCGGCTATGTCGTGGGCGGCATCGTGGGCGGTGCCTGCGTGCCGCCGCTTATG
GGGGCTGTGGCAGATGCCAGGGGCACGGCTATGGGCATGACGGTGCCTTTGGGATTCCTCGCTGCCGGTTGGACG
TATGCGCTGGCGGTGAATGCGGTGCCGGCCTATCGGGCTGTTATTGATGGGGGAAACAGCGTGGAGTCTGACTCA
GAGGGGGACGGGGAGCCTGTCATGGAGAGGAGTGGGGAGGGCGTGTTGGAGCTGGGGAGGCGTTGGCGTCGGGGA
Transcript >Ophio5|3104
ATGTTCCAACATCGAGACTCTTCCCCACGCGCCGAGCTCACGGGCCGTCAGTCGTTGTATCCCGTCTGTCTCGTC
ACCAGCCTCTTCTTCCTTTGGGGTTTCTCCTACGGCCTTCTTGACACGCTCAACAAGCACTTTCAAGACACGCTG
GGCATTGGCAAGTCACGATCTGCCGGTCTTCAAGCCGCCTACTTTGGAGCATACCCCCTGGCCTCGCTCGGTCAT
GCCGCCTGGACCTTGCAGCGGTTCGGTTACCGCGCCACCTTTGTCTGGGGCCTCTGTCTCTACGGCCTGGGGGCC
GTCTTGGCCATTCCAGCCATCAAGTGTCGGAGCTTCGGTGGTTTCTGCGCCTGCATCTTCGTTATTGGTAGCGGA
CTGGGCTCTCTCGAGACGGCTGCGAATCCGTACATGGGTGCTTGCGGTCCTGCACGATACTCCGAGATACGGCTC
AACATTGCGCAAGCCTTTAGCGGCGTAGGATCCGTCGTCGCTCCCGTCGTCGGCTCCTTCGCCTTCTTCCGGCTG
GATGCTGAGGGCGCGCTACAAAATGTTCAGTGGATCTACCTGGCTGTTGCCCTGCTCGTTTTTGCCCTCGCCGTC
ATCTTCTTCATATCTGACATCCCCGAGGCGTACGAAGACGATGATGAAACGATGGCCAAGGGCGACAACGGCGGG
CTGACATCGTCGCAACGATGGCGTCTTTTGCACGCGGCGTTGGCCCAGTTTTGCTGTACGGGCGCGCAGATTGCC
ATTGCCGGATACTTCATCAACTACGTGACGGAGACGCGACCTCGGACAAGACCGGCGCTGGCCTCGCAGCTCCTG
GCAGGTGCTCAAGGGGCCTTTGCCTTGGGTCGTTTTGTCGGCGCGGCACTGATGCGCTTCATCCGTCCGCGGGTA
GTTCTATGCGCTTTCACGACGCTGAGCGTCGCCCTGGTCGCTCCCGCCGTGGCCCTGCGCGGAAACTCGGGCGTC
CTGGTCATCTGTCTGTCCATGTTCTTCGAGTCAGTATGCTTTCCAACCATCGTGGCGCTGGGGATCCGGGGCCTG
GGCCGGCACAGCCGTCGAGGCTCCGGCTATGTCGTGGGCGGCATCGTGGGCGGTGCCTGCGTGCCGCCGCTTATG
GGGGCTGTGGCAGATGCCAGGGGCACGGCTATGGGCATGACGGTGCCTTTGGGATTCCTCGCTGCCGGTTGGACG
TATGCGCTGGCGGTGAATGCGGTGCCGGCCTATCGGGCTGTTATTGATGGGGGAAACAGCGTGGAGTCTGACTCA
GAGGGGGACGGGGAGCCTGTCATGGAGAGGAGTGGGGAGGGCGTGTTGGAGCTGGGGAGGCGTTGGCGTCGGGGA
TAG
Gene >Ophio5|3104
ATGTTCCAACATCGAGACTCTTCCCCACGCGCCGAGCTCACGGGCCGTCAGTCGTTGTATCCCGTCTGTCTCGTC
ACCAGCCTCTTCTTCCTTTGGGGTTTCTCCTACGGCCTTCTTGACACGCTCAACAAGCACTTTCAAGACACGCTG
GGCATTGGCAAGTCACGATCTGCCGGTCTTCAAGCCGCCTACTTTGGGTGTGTACATTCTTCGTCCTCCTTCTCC
TCCTCTTTCTTATCTTCTTCTCGGATCCTGACTCCTCCCCCACATGTAGAGCATACCCCCTGGCCTCGCTCGGTC
ATGCCGCCTGGACCTTGCAGCGGTTCGGTTACCGCGCCACCTTTGTCTGGGGCCTCTGTCTCTACGGTATGTGCC
GGGAATGGCCCTGTTTCTATCTAGCCTTGGCTCACGCGATGCTCGACCCGCTCCAGGCCTGGGGGCCGTCTTGGC
CATTCCAGCCATCAAGTGTCGGAGCTTCGGTGGTTTCTGCGCCTGCATCTTCGTTATTGGTAGCGGACTGGGCTC
TCTCGAGACGGCTGCGAATCCGTACATGGGTGGTGCGTGTATTCCATCCCATTTCCCCCCCTTTCTCTGTCTCTA
CTCAATCTTTTATAGTCGGACGCTGGCTGAAGAAGCTCTAGCTTGCGGTCCTGCACGATACTCCGAGATACGGCT
CAACATTGCGCAAGCCTTTAGCGGCGTAGGATCCGTCGTCGCTCCCGTCGTCGGCTCCTTCGCCTTCTTCCGGCT
GGATGCTGAGGGCGCGCTACAAAATGTTCAGTGGATCTACCTGGCTGTTGCCCTGCTCGTTTTTGCCCTCGCCGT
CATCTTCTTCATATCTGACATCCCCGAGGCGTACGAAGACGATGATGAAACGATGGCCAAGGGCGACAACGGCGG
GCTGACATCGTCGCAACGATGGCGTCTTTTGCACGCGGCGTTGGCCCAGTTTTGCTGTACGGGCGCGCAGATTGC
CATTGCCGGGTAAGAAGGCTGCATCGTGAAAAGAAGTCGGTCGAGAATACTGAAGAGCAATGTCCCTTGCTTCGC
ACAGATACTTCATCAACTACGTGACGGAGACGCGACCTCGGACAAGACCGGCGCTGGCCTCGCAGCTCCTGGCAG
GTGCTCAAGGGGCCTTTGCCTTGGGTCGTTTTGTCGGCGCGGCACTGATGCGCTTCATCCGTCCGCGGGTAGTTC
TATGCGCTTTCACGACGCTGAGCGTCGCCCTGGTCGCTCCCGCCGTGGCCCTGCGCGGAAACTCGGGCGTCCTGG
TCATCTGTCTGTCCATGTTCTTCGAGTCAGTATGCTTTCCAACCATCGTGGCGCTGGGGATCCGGGGCCTGGGCC
GGCACAGCCGTCGAGGCTCCGGCTATGTCGTGGGCGGCATCGTGGGCGGTGCCTGCGTGCCGCCGCTTATGGGGG
CTGTGGCAGATGCCAGGGGCACGGCTATGGGCATGACGGTGCCTTTGGGATTCCTCGCTGCCGGTTGGACGTATG
CGCTGGCGGTGAATGCGGTGCCGGCCTATCGGGCTGTTATTGATGGGGGAAACAGCGTGGAGTCTGACTCAGAGG
GGGACGGGGAGCCTGTCATGGAGAGGAGTGGGGAGGGCGTGTTGGAGCTGGGGAGGCGTTGGCGTCGGGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail