Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3104
Gene name
Locationscaffold_247:17905..19554
Strand-
Gene length (bp)1649
Transcript length (bp)1353
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.3E-13 28 352

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 15 384 1.0E-55
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 7 392 2.0E-50
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 7 392 2.0E-50
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 7 392 1.0E-48
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 10 388 1.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11551|FUCP_ECOLI L-fucose-proton symporter OS=Escherichia coli (strain K12) GN=fucP PE=1 SV=3 15 384 1.0E-55
sp|P0C105|GLUP_BRUAB Glucose/galactose transporter OS=Brucella abortus biovar 1 (strain 9-941) GN=gluP PE=3 SV=1 7 392 2.0E-50
sp|Q2YIJ8|GLUP_BRUA2 Glucose/galactose transporter OS=Brucella abortus (strain 2308) GN=gluP PE=3 SV=1 7 392 2.0E-50
sp|Q8YB48|GLUP_BRUME Glucose/galactose transporter OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gluP PE=3 SV=1 7 392 1.0E-48
sp|P44776|FUCP_HAEIN L-fucose permease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fucP PE=3 SV=1 10 388 1.0E-36
sp|O25788|GLUP_HELPY Putative glucose/galactose transporter OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gluP PE=3 SV=1 25 380 9.0E-30
sp|Q9ZK41|GLUP_HELPJ Putative glucose/galactose transporter OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gluP PE=3 SV=1 25 380 5.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 20 39 19
2 83 105 22
3 112 131 19
4 151 173 22
5 186 208 22
6 237 259 22
7 300 319 19
8 323 345 22
9 357 379 22
10 383 405 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3104
MFQHRDSSPRAELTGRQSLYPVCLVTSLFFLWGFSYGLLDTLNKHFQDTLGIGKSRSAGLQAAYFGAYPLASLGH
AAWTLQRFGYRATFVWGLCLYGLGAVLAIPAIKCRSFGGFCACIFVIGSGLGSLETAANPYMGACGPARYSEIRL
NIAQAFSGVGSVVAPVVGSFAFFRLDAEGALQNVQWIYLAVALLVFALAVIFFISDIPEAYEDDDETMAKGDNGG
LTSSQRWRLLHAALAQFCCTGAQIAIAGYFINYVTETRPRTRPALASQLLAGAQGAFALGRFVGAALMRFIRPRV
VLCAFTTLSVALVAPAVALRGNSGVLVICLSMFFESVCFPTIVALGIRGLGRHSRRGSGYVVGGIVGGACVPPLM
GAVADARGTAMGMTVPLGFLAAGWTYALAVNAVPAYRAVIDGGNSVESDSEGDGEPVMERSGEGVLELGRRWRRG
Coding >Ophio5|3104
ATGTTCCAACATCGAGACTCTTCCCCACGCGCCGAGCTCACGGGCCGTCAGTCGTTGTATCCCGTCTGTCTCGTC
ACCAGCCTCTTCTTCCTTTGGGGTTTCTCCTACGGCCTTCTTGACACGCTCAACAAGCACTTTCAAGACACGCTG
GGCATTGGCAAGTCACGATCTGCCGGTCTTCAAGCCGCCTACTTTGGAGCATACCCCCTGGCCTCGCTCGGTCAT
GCCGCCTGGACCTTGCAGCGGTTCGGTTACCGCGCCACCTTTGTCTGGGGCCTCTGTCTCTACGGCCTGGGGGCC
GTCTTGGCCATTCCAGCCATCAAGTGTCGGAGCTTCGGTGGTTTCTGCGCCTGCATCTTCGTTATTGGTAGCGGA
CTGGGCTCTCTCGAGACGGCTGCGAATCCGTACATGGGTGCTTGCGGTCCTGCACGATACTCCGAGATACGGCTC
AACATTGCGCAAGCCTTTAGCGGCGTAGGATCCGTCGTCGCTCCCGTCGTCGGCTCCTTCGCCTTCTTCCGGCTG
GATGCTGAGGGCGCGCTACAAAATGTTCAGTGGATCTACCTGGCTGTTGCCCTGCTCGTTTTTGCCCTCGCCGTC
ATCTTCTTCATATCTGACATCCCCGAGGCGTACGAAGACGATGATGAAACGATGGCCAAGGGCGACAACGGCGGG
CTGACATCGTCGCAACGATGGCGTCTTTTGCACGCGGCGTTGGCCCAGTTTTGCTGTACGGGCGCGCAGATTGCC
ATTGCCGGATACTTCATCAACTACGTGACGGAGACGCGACCTCGGACAAGACCGGCGCTGGCCTCGCAGCTCCTG
GCAGGTGCTCAAGGGGCCTTTGCCTTGGGTCGTTTTGTCGGCGCGGCACTGATGCGCTTCATCCGTCCGCGGGTA
GTTCTATGCGCTTTCACGACGCTGAGCGTCGCCCTGGTCGCTCCCGCCGTGGCCCTGCGCGGAAACTCGGGCGTC
CTGGTCATCTGTCTGTCCATGTTCTTCGAGTCAGTATGCTTTCCAACCATCGTGGCGCTGGGGATCCGGGGCCTG
GGCCGGCACAGCCGTCGAGGCTCCGGCTATGTCGTGGGCGGCATCGTGGGCGGTGCCTGCGTGCCGCCGCTTATG
GGGGCTGTGGCAGATGCCAGGGGCACGGCTATGGGCATGACGGTGCCTTTGGGATTCCTCGCTGCCGGTTGGACG
TATGCGCTGGCGGTGAATGCGGTGCCGGCCTATCGGGCTGTTATTGATGGGGGAAACAGCGTGGAGTCTGACTCA
GAGGGGGACGGGGAGCCTGTCATGGAGAGGAGTGGGGAGGGCGTGTTGGAGCTGGGGAGGCGTTGGCGTCGGGGA
Transcript >Ophio5|3104
ATGTTCCAACATCGAGACTCTTCCCCACGCGCCGAGCTCACGGGCCGTCAGTCGTTGTATCCCGTCTGTCTCGTC
ACCAGCCTCTTCTTCCTTTGGGGTTTCTCCTACGGCCTTCTTGACACGCTCAACAAGCACTTTCAAGACACGCTG
GGCATTGGCAAGTCACGATCTGCCGGTCTTCAAGCCGCCTACTTTGGAGCATACCCCCTGGCCTCGCTCGGTCAT
GCCGCCTGGACCTTGCAGCGGTTCGGTTACCGCGCCACCTTTGTCTGGGGCCTCTGTCTCTACGGCCTGGGGGCC
GTCTTGGCCATTCCAGCCATCAAGTGTCGGAGCTTCGGTGGTTTCTGCGCCTGCATCTTCGTTATTGGTAGCGGA
CTGGGCTCTCTCGAGACGGCTGCGAATCCGTACATGGGTGCTTGCGGTCCTGCACGATACTCCGAGATACGGCTC
AACATTGCGCAAGCCTTTAGCGGCGTAGGATCCGTCGTCGCTCCCGTCGTCGGCTCCTTCGCCTTCTTCCGGCTG
GATGCTGAGGGCGCGCTACAAAATGTTCAGTGGATCTACCTGGCTGTTGCCCTGCTCGTTTTTGCCCTCGCCGTC
ATCTTCTTCATATCTGACATCCCCGAGGCGTACGAAGACGATGATGAAACGATGGCCAAGGGCGACAACGGCGGG
CTGACATCGTCGCAACGATGGCGTCTTTTGCACGCGGCGTTGGCCCAGTTTTGCTGTACGGGCGCGCAGATTGCC
ATTGCCGGATACTTCATCAACTACGTGACGGAGACGCGACCTCGGACAAGACCGGCGCTGGCCTCGCAGCTCCTG
GCAGGTGCTCAAGGGGCCTTTGCCTTGGGTCGTTTTGTCGGCGCGGCACTGATGCGCTTCATCCGTCCGCGGGTA
GTTCTATGCGCTTTCACGACGCTGAGCGTCGCCCTGGTCGCTCCCGCCGTGGCCCTGCGCGGAAACTCGGGCGTC
CTGGTCATCTGTCTGTCCATGTTCTTCGAGTCAGTATGCTTTCCAACCATCGTGGCGCTGGGGATCCGGGGCCTG
GGCCGGCACAGCCGTCGAGGCTCCGGCTATGTCGTGGGCGGCATCGTGGGCGGTGCCTGCGTGCCGCCGCTTATG
GGGGCTGTGGCAGATGCCAGGGGCACGGCTATGGGCATGACGGTGCCTTTGGGATTCCTCGCTGCCGGTTGGACG
TATGCGCTGGCGGTGAATGCGGTGCCGGCCTATCGGGCTGTTATTGATGGGGGAAACAGCGTGGAGTCTGACTCA
GAGGGGGACGGGGAGCCTGTCATGGAGAGGAGTGGGGAGGGCGTGTTGGAGCTGGGGAGGCGTTGGCGTCGGGGA
TAG
Gene >Ophio5|3104
ATGTTCCAACATCGAGACTCTTCCCCACGCGCCGAGCTCACGGGCCGTCAGTCGTTGTATCCCGTCTGTCTCGTC
ACCAGCCTCTTCTTCCTTTGGGGTTTCTCCTACGGCCTTCTTGACACGCTCAACAAGCACTTTCAAGACACGCTG
GGCATTGGCAAGTCACGATCTGCCGGTCTTCAAGCCGCCTACTTTGGGTGTGTACATTCTTCGTCCTCCTTCTCC
TCCTCTTTCTTATCTTCTTCTCGGATCCTGACTCCTCCCCCACATGTAGAGCATACCCCCTGGCCTCGCTCGGTC
ATGCCGCCTGGACCTTGCAGCGGTTCGGTTACCGCGCCACCTTTGTCTGGGGCCTCTGTCTCTACGGTATGTGCC
GGGAATGGCCCTGTTTCTATCTAGCCTTGGCTCACGCGATGCTCGACCCGCTCCAGGCCTGGGGGCCGTCTTGGC
CATTCCAGCCATCAAGTGTCGGAGCTTCGGTGGTTTCTGCGCCTGCATCTTCGTTATTGGTAGCGGACTGGGCTC
TCTCGAGACGGCTGCGAATCCGTACATGGGTGGTGCGTGTATTCCATCCCATTTCCCCCCCTTTCTCTGTCTCTA
CTCAATCTTTTATAGTCGGACGCTGGCTGAAGAAGCTCTAGCTTGCGGTCCTGCACGATACTCCGAGATACGGCT
CAACATTGCGCAAGCCTTTAGCGGCGTAGGATCCGTCGTCGCTCCCGTCGTCGGCTCCTTCGCCTTCTTCCGGCT
GGATGCTGAGGGCGCGCTACAAAATGTTCAGTGGATCTACCTGGCTGTTGCCCTGCTCGTTTTTGCCCTCGCCGT
CATCTTCTTCATATCTGACATCCCCGAGGCGTACGAAGACGATGATGAAACGATGGCCAAGGGCGACAACGGCGG
GCTGACATCGTCGCAACGATGGCGTCTTTTGCACGCGGCGTTGGCCCAGTTTTGCTGTACGGGCGCGCAGATTGC
CATTGCCGGGTAAGAAGGCTGCATCGTGAAAAGAAGTCGGTCGAGAATACTGAAGAGCAATGTCCCTTGCTTCGC
ACAGATACTTCATCAACTACGTGACGGAGACGCGACCTCGGACAAGACCGGCGCTGGCCTCGCAGCTCCTGGCAG
GTGCTCAAGGGGCCTTTGCCTTGGGTCGTTTTGTCGGCGCGGCACTGATGCGCTTCATCCGTCCGCGGGTAGTTC
TATGCGCTTTCACGACGCTGAGCGTCGCCCTGGTCGCTCCCGCCGTGGCCCTGCGCGGAAACTCGGGCGTCCTGG
TCATCTGTCTGTCCATGTTCTTCGAGTCAGTATGCTTTCCAACCATCGTGGCGCTGGGGATCCGGGGCCTGGGCC
GGCACAGCCGTCGAGGCTCCGGCTATGTCGTGGGCGGCATCGTGGGCGGTGCCTGCGTGCCGCCGCTTATGGGGG
CTGTGGCAGATGCCAGGGGCACGGCTATGGGCATGACGGTGCCTTTGGGATTCCTCGCTGCCGGTTGGACGTATG
CGCTGGCGGTGAATGCGGTGCCGGCCTATCGGGCTGTTATTGATGGGGGAAACAGCGTGGAGTCTGACTCAGAGG
GGGACGGGGAGCCTGTCATGGAGAGGAGTGGGGAGGGCGTGTTGGAGCTGGGGAGGCGTTGGCGTCGGGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail