Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|3102
Gene name
Locationscaffold_247:12903..13727
Strand+
Gene length (bp)824
Transcript length (bp)756
Coding sequence length (bp)753
Protein length (aa) 251

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.0E-14 66 159
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.0E-09 128 190
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.3E-09 156 224
PF13637 Ank_4 Ankyrin repeats (many copies) 9.2E-05 67 114
PF13637 Ank_4 Ankyrin repeats (many copies) 1.5E-06 110 148
PF13637 Ank_4 Ankyrin repeats (many copies) 1.2E-08 129 174
PF13637 Ank_4 Ankyrin repeats (many copies) 4.7E-06 163 216
PF13606 Ank_3 Ankyrin repeat 1.0E-03 128 156
PF00023 Ank Ankyrin repeat 2.5E-02 94 124
PF00023 Ank Ankyrin repeat 2.9E-03 128 156
PF00023 Ank Ankyrin repeat 3.0E-02 197 217

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 79 249 5.0E-16
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 79 249 6.0E-15
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 76 219 2.0E-14
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 76 219 2.0E-14
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 76 229 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 79 249 5.0E-16
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 79 249 6.0E-15
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 76 219 2.0E-14
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 76 219 2.0E-14
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 76 229 2.0E-13
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 76 241 4.0E-13
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 76 218 7.0E-13
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 53 216 1.0E-12
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 76 239 2.0E-12
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 53 250 2.0E-12
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 67 251 3.0E-12
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 96 251 3.0E-12
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 53 216 4.0E-12
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 53 216 4.0E-12
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 76 218 4.0E-12
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 78 249 6.0E-12
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 76 218 6.0E-12
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 78 249 6.0E-12
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 64 237 7.0E-12
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 53 216 8.0E-12
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 80 249 9.0E-12
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 78 251 9.0E-12
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 67 251 9.0E-12
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 91 216 2.0E-11
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 91 216 2.0E-11
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 72 221 2.0E-11
sp|P31695|NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 80 251 3.0E-11
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 94 249 4.0E-11
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 122 247 5.0E-11
sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 75 249 5.0E-11
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 76 234 5.0E-11
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 80 241 7.0E-11
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 76 241 9.0E-11
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 94 245 1.0E-10
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 76 241 1.0E-10
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 63 247 1.0E-10
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 76 241 1.0E-10
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 75 250 2.0E-10
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 72 226 2.0E-10
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 76 241 2.0E-10
sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 80 251 2.0E-10
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 78 249 3.0E-10
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 91 216 3.0E-10
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 79 241 3.0E-10
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 76 237 3.0E-10
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 74 237 3.0E-10
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 80 251 3.0E-10
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 75 249 4.0E-10
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 80 241 5.0E-10
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 109 247 6.0E-10
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 50 250 6.0E-10
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 96 249 6.0E-10
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 80 241 6.0E-10
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 94 249 7.0E-10
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 76 241 8.0E-10
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 53 216 1.0E-09
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 78 249 1.0E-09
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 61 251 1.0E-09
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 78 216 2.0E-09
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 61 251 2.0E-09
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 57 251 2.0E-09
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 78 249 2.0E-09
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 78 249 3.0E-09
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 78 249 3.0E-09
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 83 244 3.0E-09
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 78 249 3.0E-09
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 70 250 3.0E-09
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 76 216 3.0E-09
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 79 249 3.0E-09
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 73 246 3.0E-09
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 89 249 4.0E-09
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 83 237 4.0E-09
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 70 216 4.0E-09
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 76 243 4.0E-09
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 67 173 4.0E-09
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 64 218 4.0E-09
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 96 242 5.0E-09
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 70 216 6.0E-09
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 64 216 6.0E-09
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 93 241 6.0E-09
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 76 243 6.0E-09
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 64 218 6.0E-09
sp|Q1RJR4|Y319_RICBR Putative ankyrin repeat protein RBE_0319 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0319 PE=4 SV=1 98 235 6.0E-09
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 78 247 7.0E-09
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 81 237 7.0E-09
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 67 241 7.0E-09
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 67 241 7.0E-09
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 76 243 8.0E-09
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 86 244 1.0E-08
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 64 250 1.0E-08
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 55 251 1.0E-08
sp|Q1RJR4|Y319_RICBR Putative ankyrin repeat protein RBE_0319 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0319 PE=4 SV=1 63 249 1.0E-08
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 86 237 1.0E-08
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 64 218 1.0E-08
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 70 238 1.0E-08
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 81 237 1.0E-08
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 79 215 1.0E-08
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 57 251 1.0E-08
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 75 242 1.0E-08
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 78 226 1.0E-08
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 58 215 1.0E-08
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 70 250 2.0E-08
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 70 249 2.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 109 249 2.0E-08
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 76 249 2.0E-08
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 67 216 2.0E-08
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 76 250 2.0E-08
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 96 249 2.0E-08
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 76 249 2.0E-08
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 88 249 2.0E-08
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 76 249 2.0E-08
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 76 249 2.0E-08
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 70 238 2.0E-08
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 106 249 2.0E-08
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 79 215 2.0E-08
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 67 240 2.0E-08
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 80 242 2.0E-08
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 61 251 2.0E-08
sp|Q52T38|ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 90 242 2.0E-08
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 78 249 3.0E-08
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 64 250 3.0E-08
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 83 241 3.0E-08
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 76 250 3.0E-08
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 64 242 3.0E-08
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 70 249 4.0E-08
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 76 251 4.0E-08
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 63 217 4.0E-08
sp|Q2QLB5|ASZ1_CALMO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 43 249 4.0E-08
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 76 249 5.0E-08
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 91 249 5.0E-08
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 52 241 5.0E-08
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 71 241 5.0E-08
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 78 250 5.0E-08
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 93 241 5.0E-08
sp|F1REV3|KRIT1_DANRE Krev interaction trapped protein 1 OS=Danio rerio GN=krit1 PE=1 SV=1 97 207 5.0E-08
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 63 217 5.0E-08
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 87 249 5.0E-08
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 87 249 5.0E-08
sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 52 249 5.0E-08
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 76 249 6.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 76 249 6.0E-08
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 76 249 6.0E-08
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 118 249 6.0E-08
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 80 242 6.0E-08
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 79 215 6.0E-08
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 76 249 7.0E-08
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 76 249 7.0E-08
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 89 249 8.0E-08
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 76 216 8.0E-08
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 106 249 8.0E-08
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 87 249 8.0E-08
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 69 237 8.0E-08
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 92 249 9.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 76 250 9.0E-08
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 74 242 9.0E-08
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 96 249 1.0E-07
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 76 249 1.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 76 249 1.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 92 249 1.0E-07
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 78 249 1.0E-07
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 76 216 1.0E-07
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 76 217 1.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 76 249 1.0E-07
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 67 186 1.0E-07
sp|P55273|CDN2D_HUMAN Cyclin-dependent kinase 4 inhibitor D OS=Homo sapiens GN=CDKN2D PE=1 SV=1 121 251 1.0E-07
sp|Q6S5J6|KRIT1_MOUSE Krev interaction trapped protein 1 OS=Mus musculus GN=Krit1 PE=1 SV=1 97 209 1.0E-07
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 61 221 1.0E-07
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 79 215 1.0E-07
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 78 249 2.0E-07
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 78 216 2.0E-07
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 67 249 2.0E-07
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 64 249 2.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 76 241 2.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 76 250 2.0E-07
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 75 241 2.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 76 249 2.0E-07
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 89 249 2.0E-07
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 70 250 2.0E-07
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 89 216 2.0E-07
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 106 241 2.0E-07
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 64 246 2.0E-07
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 63 217 2.0E-07
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 89 249 2.0E-07
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 58 241 2.0E-07
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 80 251 2.0E-07
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 79 215 2.0E-07
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 65 250 3.0E-07
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 96 249 3.0E-07
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 67 216 3.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 64 243 3.0E-07
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 122 237 3.0E-07
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 66 182 3.0E-07
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 68 251 3.0E-07
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 68 251 3.0E-07
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 70 216 3.0E-07
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 11 240 3.0E-07
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 101 241 3.0E-07
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 68 251 3.0E-07
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 106 246 3.0E-07
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 89 237 3.0E-07
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 52 237 3.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 79 237 4.0E-07
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 69 249 4.0E-07
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 70 217 4.0E-07
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 80 237 4.0E-07
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 89 241 4.0E-07
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 104 246 4.0E-07
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 79 215 4.0E-07
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 86 240 4.0E-07
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 78 249 4.0E-07
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 79 215 4.0E-07
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 79 215 4.0E-07
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 79 215 4.0E-07
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 66 182 4.0E-07
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 67 249 4.0E-07
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 96 249 4.0E-07
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 91 242 4.0E-07
sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 91 241 4.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 79 237 5.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 95 250 5.0E-07
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 61 211 5.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 64 218 5.0E-07
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 78 249 5.0E-07
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 96 249 5.0E-07
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 70 215 5.0E-07
sp|Q2IBF5|ASZ1_GORGO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 78 249 5.0E-07
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 68 251 5.0E-07
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 78 249 5.0E-07
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 40 240 5.0E-07
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 68 251 5.0E-07
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 63 217 5.0E-07
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 95 216 5.0E-07
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 64 217 5.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 76 250 6.0E-07
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 70 250 6.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 95 250 6.0E-07
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 101 250 6.0E-07
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 60 242 6.0E-07
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 76 246 6.0E-07
sp|Q9VSA4|TONSL_DROME Tonsoku-like protein OS=Drosophila melanogaster GN=CG7457 PE=1 SV=1 91 198 6.0E-07
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 95 216 6.0E-07
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 104 251 6.0E-07
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 88 249 6.0E-07
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 67 251 7.0E-07
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 78 249 7.0E-07
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 84 243 7.0E-07
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 89 249 7.0E-07
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 72 218 7.0E-07
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 70 241 8.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 70 217 8.0E-07
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 74 251 8.0E-07
sp|Q2IBF5|ASZ1_GORGO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 106 246 8.0E-07
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 106 246 8.0E-07
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 75 242 8.0E-07
sp|Q8WWH4|ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 106 246 8.0E-07
sp|Q8WWH4|ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 78 249 8.0E-07
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 105 246 8.0E-07
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 70 238 8.0E-07
sp|Q8WMX7|ASZ1_PAPAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 78 249 8.0E-07
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 101 244 9.0E-07
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 70 217 9.0E-07
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 64 237 9.0E-07
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 106 246 9.0E-07
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 70 246 9.0E-07
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 104 250 9.0E-07
sp|Q2IBB1|ASZ1_CHLAE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 78 249 9.0E-07
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 80 242 9.0E-07
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 67 243 1.0E-06
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 75 249 1.0E-06
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 101 244 1.0E-06
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 76 249 1.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 70 250 1.0E-06
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 78 249 1.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 94 249 1.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 102 250 1.0E-06
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 80 237 1.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 95 250 1.0E-06
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 129 249 1.0E-06
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 89 246 1.0E-06
sp|Q8WMX7|ASZ1_PAPAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 106 246 1.0E-06
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 122 249 1.0E-06
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 79 215 1.0E-06
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 104 250 1.0E-06
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 63 217 1.0E-06
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 66 180 1.0E-06
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 63 217 1.0E-06
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 64 243 1.0E-06
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 76 216 1.0E-06
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 52 242 1.0E-06
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 64 203 1.0E-06
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 63 250 1.0E-06
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 68 251 1.0E-06
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 67 249 1.0E-06
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 79 216 1.0E-06
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 104 250 1.0E-06
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 70 249 2.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 80 249 2.0E-06
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 72 249 2.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 76 249 2.0E-06
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 68 237 2.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 70 217 2.0E-06
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 70 237 2.0E-06
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 94 246 2.0E-06
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 79 216 2.0E-06
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 50 237 2.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 53 216 2.0E-06
sp|Q2IBB1|ASZ1_CHLAE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 106 246 2.0E-06
sp|Q554E7|ZDHC5_DICDI Putative ZDHHC-type palmitoyltransferase 5 OS=Dictyostelium discoideum GN=DDB_G0275097 PE=3 SV=1 67 215 2.0E-06
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 63 217 2.0E-06
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 63 217 2.0E-06
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 89 249 2.0E-06
sp|Q09YK6|ASZ1_ATEGE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 67 240 2.0E-06
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 63 217 2.0E-06
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 63 250 2.0E-06
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 79 215 2.0E-06
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 63 217 2.0E-06
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 63 217 2.0E-06
sp|Q6TNJ1|KRIT1_BOVIN Krev interaction trapped protein 1 OS=Bos taurus GN=KRIT1 PE=2 SV=1 131 243 2.0E-06
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 63 217 2.0E-06
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 63 250 2.0E-06
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 64 241 2.0E-06
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 57 204 2.0E-06
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 80 215 2.0E-06
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 69 217 2.0E-06
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 96 241 3.0E-06
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 78 249 3.0E-06
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 76 215 3.0E-06
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 67 216 3.0E-06
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 64 242 3.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 63 216 3.0E-06
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 76 216 3.0E-06
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 77 249 3.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 93 249 3.0E-06
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 79 216 3.0E-06
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 76 246 3.0E-06
sp|Q09YK6|ASZ1_ATEGE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 101 246 3.0E-06
sp|O00522|KRIT1_HUMAN Krev interaction trapped protein 1 OS=Homo sapiens GN=KRIT1 PE=1 SV=2 131 243 3.0E-06
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 11 249 3.0E-06
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 89 249 3.0E-06
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 79 219 4.0E-06
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 89 249 4.0E-06
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 122 249 4.0E-06
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 11 240 4.0E-06
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 63 217 4.0E-06
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 85 241 5.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 64 218 5.0E-06
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 91 186 5.0E-06
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 64 241 5.0E-06
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 64 249 5.0E-06
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 91 249 5.0E-06
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 11 249 5.0E-06
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 63 217 5.0E-06
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 87 250 5.0E-06
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 63 217 5.0E-06
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 48 246 5.0E-06
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 48 246 5.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 67 249 6.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 71 237 6.0E-06
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 64 241 6.0E-06
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 63 217 6.0E-06
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 93 241 6.0E-06
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 94 249 7.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 91 249 7.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 91 249 7.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 76 250 7.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 67 249 7.0E-06
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 79 241 7.0E-06
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 76 193 7.0E-06
sp|Q9HYV6|Y3287_PSEAE Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 28 166 7.0E-06
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 63 217 7.0E-06
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 128 242 7.0E-06
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 91 237 7.0E-06
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 76 241 8.0E-06
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 94 249 8.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 64 218 8.0E-06
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 72 242 8.0E-06
sp|Q9HYV6|Y3287_PSEAE Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 72 215 8.0E-06
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 79 241 9.0E-06
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 63 217 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|3102
MKLYSLITVLFAVGASCVSSGPGANGFQQGRHWRDRASFFMPLPPWTRHFKRDMMMFDALGDLLGSAVMRKNATM
VKQLLLNSSVDPGVPNSRGETPLFRAVMNDDKVVAKLLLDTGRSLPNRLDGSGWTPLAYAAMMGHEEMADLLLST
KGIEPDGKDCNGWTPLLHAAAGGYEFIVQHILAADGVEPDGQDGQMRTPLWWAVQNRHTAVVKLLLHSPKVKPTR
PDEYGVSPLDIAKRNGDDVLVNMMKG
Coding >Ophio5|3102
ATGAAGCTTTACAGCCTTATTACCGTCCTCTTCGCCGTAGGAGCATCCTGCGTCTCCAGTGGGCCAGGAGCAAAC
GGTTTTCAGCAAGGCCGTCACTGGCGTGATAGAGCCTCCTTCTTTATGCCTCTGCCCCCTTGGACGAGACACTTC
AAGCGGGATATGATGATGTTCGACGCCCTCGGGGACCTGCTCGGGTCGGCGGTGATGCGAAAGAACGCAACCATG
GTCAAACAGCTTCTTCTAAACTCAAGCGTCGACCCGGGCGTGCCCAACAGCAGAGGCGAAACACCTCTCTTTCGA
GCCGTCATGAACGACGACAAAGTGGTGGCCAAACTACTCCTCGACACCGGCAGAAGCTTACCCAACCGTCTCGAC
GGCAGCGGCTGGACTCCCCTCGCGTACGCGGCCATGATGGGCCACGAAGAGATGGCTGACCTGCTCCTCAGTACC
AAGGGTATTGAGCCCGATGGGAAGGACTGCAATGGGTGGACGCCGTTACTGCACGCTGCGGCGGGAGGGTACGAG
TTCATCGTGCAGCATATCTTGGCAGCTGACGGCGTCGAGCCGGATGGCCAGGACGGGCAGATGCGAACGCCGCTT
TGGTGGGCGGTGCAGAATAGGCATACGGCCGTTGTCAAGCTTCTCCTCCATTCGCCAAAAGTTAAGCCGACTCGT
CCGGACGAATATGGTGTCTCGCCACTGGATATTGCGAAGCGTAACGGTGACGACGTTTTGGTTAATATGATGAAA
GGG
Transcript >Ophio5|3102
ATGAAGCTTTACAGCCTTATTACCGTCCTCTTCGCCGTAGGAGCATCCTGCGTCTCCAGTGGGCCAGGAGCAAAC
GGTTTTCAGCAAGGCCGTCACTGGCGTGATAGAGCCTCCTTCTTTATGCCTCTGCCCCCTTGGACGAGACACTTC
AAGCGGGATATGATGATGTTCGACGCCCTCGGGGACCTGCTCGGGTCGGCGGTGATGCGAAAGAACGCAACCATG
GTCAAACAGCTTCTTCTAAACTCAAGCGTCGACCCGGGCGTGCCCAACAGCAGAGGCGAAACACCTCTCTTTCGA
GCCGTCATGAACGACGACAAAGTGGTGGCCAAACTACTCCTCGACACCGGCAGAAGCTTACCCAACCGTCTCGAC
GGCAGCGGCTGGACTCCCCTCGCGTACGCGGCCATGATGGGCCACGAAGAGATGGCTGACCTGCTCCTCAGTACC
AAGGGTATTGAGCCCGATGGGAAGGACTGCAATGGGTGGACGCCGTTACTGCACGCTGCGGCGGGAGGGTACGAG
TTCATCGTGCAGCATATCTTGGCAGCTGACGGCGTCGAGCCGGATGGCCAGGACGGGCAGATGCGAACGCCGCTT
TGGTGGGCGGTGCAGAATAGGCATACGGCCGTTGTCAAGCTTCTCCTCCATTCGCCAAAAGTTAAGCCGACTCGT
CCGGACGAATATGGTGTCTCGCCACTGGATATTGCGAAGCGTAACGGTGACGACGTTTTGGTTAATATGATGAAA
GGGTAG
Gene >Ophio5|3102
ATGAAGCTTTACAGCCTTATTACCGTCCTCTTCGCCGTAGGAGCATCCTGCGTCTCCAGTGGGCCAGGAGCAAAC
GGTTTTCAGGTAGGCAAGATGATGAAACTTGGACGGAACCCGTCCCCCGGCATCACTAAACGGGCAATTTTCCAC
AGCAAGGCCGTCACTGGCGTGATAGAGCCTCCTTCTTTATGCCTCTGCCCCCTTGGACGAGACACTTCAAGCGGG
ATATGATGATGTTCGACGCCCTCGGGGACCTGCTCGGGTCGGCGGTGATGCGAAAGAACGCAACCATGGTCAAAC
AGCTTCTTCTAAACTCAAGCGTCGACCCGGGCGTGCCCAACAGCAGAGGCGAAACACCTCTCTTTCGAGCCGTCA
TGAACGACGACAAAGTGGTGGCCAAACTACTCCTCGACACCGGCAGAAGCTTACCCAACCGTCTCGACGGCAGCG
GCTGGACTCCCCTCGCGTACGCGGCCATGATGGGCCACGAAGAGATGGCTGACCTGCTCCTCAGTACCAAGGGTA
TTGAGCCCGATGGGAAGGACTGCAATGGGTGGACGCCGTTACTGCACGCTGCGGCGGGAGGGTACGAGTTCATCG
TGCAGCATATCTTGGCAGCTGACGGCGTCGAGCCGGATGGCCAGGACGGGCAGATGCGAACGCCGCTTTGGTGGG
CGGTGCAGAATAGGCATACGGCCGTTGTCAAGCTTCTCCTCCATTCGCCAAAAGTTAAGCCGACTCGTCCGGACG
AATATGGTGTCTCGCCACTGGATATTGCGAAGCGTAACGGTGACGACGTTTTGGTTAATATGATGAAAGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail